DPEP2 Antibody

Images

 
Western Blot: DPEP2 Antibody [NBP2-82910] - Host: Rabbit. Target Name: DPEP2. Sample Type: OVCAR-3 Whole Cell lysates. Antibody Dilution: 1.0ug/mlDPEP2 is supported by BioGPS gene expression data to be expressed in ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DPEP2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human DPEP2. Peptide sequence: VFRQVEKVQEENKWQSPLEDKFPDEQLSSSCHSDLSRLRQRQSLTSGQEL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
DPEP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DPEP2 Antibody

  • dipeptidase 2
  • EC 3.4.13.19
  • MBD2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56326
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56519
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
NB100-56537
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
NBP1-86087
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56534
Species: Hu, Mu
Applications: ChIP, Flow, ICC, IHC, IHC-P, WB
NBP1-91189
Species: Hu, Mu(-)
Applications: ICC/IF, IHC, IHC-P, WB (-)
NB120-13888
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NB300-516
Species: Hu, Mu, Rt
Applications: ChIP, IHC, IHC-P, KD, Simple Western, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
NBP2-67451
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP1-91816
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB500-123
Species: Hu, Mu
Applications: B/N, ChIP, Func, ICC/IF, IHC, IHC-P, IP, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-82910
Species: Hu
Applications: WB

Publications for DPEP2 Antibody (NBP2-82910) (0)

There are no publications for DPEP2 Antibody (NBP2-82910).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPEP2 Antibody (NBP2-82910) (0)

There are no reviews for DPEP2 Antibody (NBP2-82910). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DPEP2 Antibody (NBP2-82910) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DPEP2 Products

Bioinformatics Tool for DPEP2 Antibody (NBP2-82910)

Discover related pathways, diseases and genes to DPEP2 Antibody (NBP2-82910). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPEP2 Antibody (NBP2-82910)

Discover more about diseases related to DPEP2 Antibody (NBP2-82910).
 

Pathways for DPEP2 Antibody (NBP2-82910)

View related products by pathway.

PTMs for DPEP2 Antibody (NBP2-82910)

Learn more about PTMs related to DPEP2 Antibody (NBP2-82910).
 

Research Areas for DPEP2 Antibody (NBP2-82910)

Find related products by research area.

Blogs on DPEP2

There are no specific blogs for DPEP2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DPEP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DPEP2