Home » DPEP2 » DPEP2 Antibodies » DPEP2 Antibody

DPEP2 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: DPEP2 Antibody [NBP2-82910] - Host: Rabbit. Target Name: DPEP2. Sample Type: OVCAR-3 Whole Cell lysates. Antibody Dilution: 1.0ug/mlDPEP2 is supported by BioGPS gene expression data to be expressed in OVCAR3
Western Blot: DPEP2 Antibody [NBP2-82910] - Host: Rabbit. Target Name: DPEP2. Sample Type: OVCAR-3 Whole Cell lysates. Antibody Dilution: 1.0ug/mlDPEP2 is supported by BioGPS gene expression data to be expressed in ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

DPEP2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human DPEP2. Peptide sequence: VFRQVEKVQEENKWQSPLEDKFPDEQLSSSCHSDLSRLRQRQSLTSGQEL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
DPEP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DPEP2 Antibody

  • dipeptidase 2
  • EC 3.4.13.19
  • MBD2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MeCP2 Antibody
NB100-56326
Western Blot: MeCP2 Antibody [NB100-56326] - Analysis of MeCP2 in HeLa cell lysate using this antibody.
Immunocytochemistry/Immunofluorescence: MeCP2 Antibody [NB100-56326] - This antibody was tested in A431 cells at a 1:200 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 568 (Red) and DAPI (Blue), respectively.
Immunohistochemistry-Paraffin: MeCP2 Antibody [NB100-56326] - Tissue section of mouse pancreas using this antibody at 1:500 dilution. The antibody generated a very strong/specific nuclear staining with weak to negligible cytoplasmic signal in majority of the cells from acini, ducts and Islets of Langerhans in the section.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
DNMT1 Antibody
(60B1220.1) - BSA Fre
NB100-56519
Flow Cytometry: DNMT1 Antibody (60B1220.1) [NB100-56519] - Analysis of PE conjugate of NB100-56519. An intracellular stain was performed on HeLa cells with DNMT1 antibody (60B1220.1) NB100-56519PE (blue) and a matched isotype control NBP2-27287PE (orange). Cells were fixed with 4% PFA and then permeablized with 0
Flow Cytometry: DNMT1 Antibody (60B1220.1) [NB100-56519] - An intracellular stain was performed on HeLa cells with DNMT1 [60B1220.1] Antibody NB100-56519AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Immunoprecipitation: DNMT1 Antibody (60B1220.1) [NB100-56519] - The PCNAS228I mutation differentially affects PCNA binding to PIP box-containing proteins. GST-PIP pull down of His-S-PCNAWT or PCNAS228I. Figure shows Coomassie stained gel of representative pull down (top) and anti-PCNA western blot of the same samples diluted 1:20 (bottom). Amount of 'input' loaded for Coomassie is equivalent to 1%, 'Glut. beads' (Glutathione sepharose 4B beads) is equivalent to 25%. Molecular weight markers are indicated. Image collected and cropped by CiteAb from the following publication (http://linkinghub.elsevier.com/retrieve/pii/S1568786416304013), licensed under a CC-BY licence.
(4 Reviews)
(125 Publications)
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
MBD1 Antibody
(100B272.1)
NB100-56537
Knockdown Validated: MBD1 Antibody (100B272.1) [NB100-56537] - blot shows lysates of HEK293T human embryonic kidney parental cell line and MBD1 knockout (KO) HEK293T cell line. PVDF membrane was probed with 2.0 ug/ml of Mouse Anti-Human MBD1 Monoclonal Antibody (Catalog # NB100-56537) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for MBD1 at approximately 60 kDa (as indicated) in the parental HEK293T cell line, but is not detectable in the knockout HEK293T cell line. This experiment was conducted under reducing conditions.
Immunocytochemistry/Immunofluorescence: MBD1 Antibody (100B272.1) [NB100-56537] - HeLa cells were fixed for 10 minutes using 4% PFA and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-MBD1 (100B272.1) at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunocytochemistry/Immunofluorescence: MBD1 Antibody (100B272.1) [NB100-56537] - NIH3T3 cells were fixed for 10 minutes using 4% PFA and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-MBD1 (100B272.1) at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(2 Reviews)
(8 Publications)
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
DPEP1 Antibody
NBP1-86087
Immunohistochemistry-Paraffin: DPEP1 Antibody [NBP1-86087] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: DPEP1 Antibody [NBP1-86087] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: DPEP1 Antibody [NBP1-86087] - Staining in human kidney and lymph node tissues using anti-DPEP1 antibody. Corresponding DPEP1 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MBD3 Antibody
(106B691) - BSA Free
NB100-56534
Immunohistochemistry-Paraffin: MBD3 Antibody (106B691) [NB100-56534] - MBD3 was detected in immersion fixed paraffin-embedded sections of human placenta using Mouse Anti-Human MBD3 (106B691) Monoclonal Antibody (Catalog # NB100-56534) at 1:300 for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cell nuclei in horionic villi.
Western Blot: MBD3 Antibody (106B691) [NB100-56534] - Analysis of MBD2 and MBD3 using this antibody. HeLa cell lysate (nuclear fraction) probed with MBD3/2 antibody at 2 ug/ml in the A) absence and B) presence of immunizing peptide.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: ChIP, Flow, ICC, IHC, IHC-P, WB
MBD4 Antibody -
BSA Free
NBP1-91189
Immunocytochemistry/Immunofluorescence: MBD4 Antibody [NBP1-91189] - MBD4 antibody was tested in HeLa cells with FITC (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry: MBD4 Antibody [NBP1-91189] - IHC analysis of MBD4 in human breast cancer cells using DAB with hematoxylin counterstain.
(1 Publication)
Species: Hu, Mu(-)
Applications: ICC/IF, IHC, IHC-P, WB (-)
DNMT3A Antibody
(64B1446) - BSA Free
NB120-13888
Western Blot: DNMT3A Antibody (64B1446) [NB120-13888] - NTERA-2 cells were treated with Zebularine as indicated for 24 hours. Cell lysates were prepared and separated on a 7.5% gel by SDS-PAGE. Protein was transferred to PVDF membrane and blocked in 5% non-fat milk. The membrane was probed with 2 ug/mL anti-Dnmt3a in 1% milk, and detected with an anti-mouse HRP secondary antibody using chemiluminescence. Note the decrease in Dnmt3a expression upon treatment with 500 uM Zebularine (arrowhead). Additional bands at 90 and 75 kDa can also be detected with this antibody and may represent alternative splice variants. Tubulin is shown as a loading control.
Flow Cytometry: DNMT3A Antibody (64B1446) [NB120-13888] - An intracellular stain was performed on HepG2 cells with DNMT3A (64B1446) NB120-13888APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to allophycocyanin (APC).
Flow Cytometry: DNMT3A Antibody (64B1446) [NB120-13888] - An intracellular stain was performed on HepG2 cells with DNMT3A (64B1446) NB120-13888AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
(3 Reviews)
(111 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
HDAC1 Antibody
NB100-56340
Knockout Validated: HDAC1 Antibody [NB100-56340] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and HDAC1 knockout (KO) HeLa cell line. PVDF membrane was probed with 2.0 ug/ml of Rabbit Anti-Human HDAC1 Polyclonal Antibody (Catalog # NB100-56340) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for HDAC1 at approximately 65 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Simple Western: HDAC1 Antibody [NB100-56340] - Simple Western lane view shows a specific band for HDAC1 in 0.5 mg/ml of HEK293 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Western Blot: HDAC1 Antibody [NB100-56340] - Analysis of HDAC1 in HEK293 cell lysate with this antibody.
(2 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
DNMT3B Antibody
NB300-516
Western Blot: DNMT3B Antibody [NB300-516] - Western blot analysis of DNMT3B level in wildtype DOK cells (Wt), Are-L and NNK-L DOK cells after treatment with 5-aza-dC (5uM) for 5 days. a-tubulin was used as internal control. Image collected and cropped by CiteAb from the following publication (jbiomedsci.biomedcentral.com/articles/10.1186/s12929-020-00644-z), licensed under a CC-BY licence.
Knockdown Validated: DNMT3B Antibody [NB300-516] - RT-PCR and Western blot analysis of DNMT3B in SCC-15 and OEC-M1 cells following DNMT3B knockdown (si-DNMT3B) or non-targeting siRNA control (si-SC) for 48h. GAPDH and a-tubulin were used as internal control, respectively. Image collected and cropped by CiteAb from the following publication (jbiomedsci.biomedcentral.com/articles/10.1186/s12929-020-00644-z), licensed under a CC-BY licence.
Western Blot: DNMT3B Antibody [NB300-516] - Expression level of DNMT3B by RT-PCR and Western blot (W.B.) analysis in human oral keratinocyte (HOK) and OSCC cell lines. GAPDH and a-tubulin were used as internal control, respectively. Image collected and cropped by CiteAb from the following publication (jbiomedsci.biomedcentral.com/articles/10.1186/s12929-020-00644-z), licensed under a CC-BY licence.
(3 Reviews)
(13 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, IHC, IHC-P, KD, Simple Western, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p19ARF/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(1 Review)
(46 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
HDAC9 Antibody -
BSA Free
NBP2-03993
Western Blot: HDAC9 Antibody [NBP2-03993] - Analysis of HDAC-9 in human HeLa cell lysate in the 1) absence and 2) presence of immunizing peptide and 3) and mouse RAW cell lysate using this antibody. 0 ug/ml, 1.0 ug/ml and 0.5 ug/ml respectively. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
(1 Review)
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
Histone
Deacetylase 2/HDAC2 A ...
NBP2-67451
Flow Cytometry: Histone Deacetylase 2/HDAC2 Antibody (SY29-02) [NBP2-67451] - Analysis of Hela cells with HDAC2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: Histone Deacetylase 2/HDAC2 Antibody (SY29-02) [NBP2-67451] - Staining HDAC2 in 293 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Histone Deacetylase 2/HDAC2 Antibody (SY29-02) [NBP2-67451] - Staining HDAC2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
CXXC1 Antibody
NBP1-91816
Immunohistochemistry-Paraffin: CXXC1 Antibody [NBP1-91816] - Staining of human stomach shows nuclear and cytoplasmic positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: CXXC1 Antibody [NBP1-91816] - Immunofluorescent staining of human cell line HeLa shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: CXXC1 Antibody [NBP1-91816] - Staining of human Staining of human lymph node. shows strong nuclear positivity in non-germinal center cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
HIST1H4F
Overexpression Lysate
NBP2-07996
Western Blot: HIST1H4F Overexpression Lysate (Adult Normal) [NBP2-07996] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for HIST1H4F.
Species: Hu
Applications: WB
H4/n Antibody
(3E7H2) - BSA Free
NBP2-52486
ELISA: H4/n Antibody (3E7H2) [NBP2-52486] - Black line: Control Antigen (100 ng); Purple line: Antigen(10ng); Blue line: Antigen (50 ng); Red line: Antigen (100 ng).
Western Blot: H4/n Antibody (3E7H2) [NBP2-52486] - Analysis using HIST2H4A(20Me) mouse mAb against THP-1 (1) cell lysate.
Flow Cytometry: H4/n Antibody (3E7H2) [NBP2-52486] - Analysis of Raji cells using HIST2H4A(20Me) mouse mAb (green) and negative control (red).
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
RBBP4/RbAp48
Antibody (11G10)
NB500-123
Immunoprecipitation: RBBP4/RbAp48 Antibody (11G10) [NB500-123] - Myc-tag antibody immunoprecipitation confirmed pulldown of NuRD component RbAp48 which is known to interact with ZNF827. * denotes IgG band at 55 kDa. Image submitted by a verified customer review.
Immunohistochemistry: RbAp48 Antibody (1D11) [NB500-123]
Immunocytochemistry/Immunofluorescence: RbAp48 Antibody (1D11) [NB500-123] - Immunofluorescence analysis of HeLa, using RbAp48 antibody at 1:100 dilution.
(1 Review)
(5 Publications)
Species: Hu, Mu
Applications: B/N, ChIP, Func, ICC/IF, IHC, IHC-P, IP, WB
Histone H3
[Trimethyl Lys9] Anti ...
NBP1-30141
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence. Observed molecular weight is ~15 kDa.
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Representative Western blot showing M-track protein protein proximity signals obtained for Kic1. Hog1-protA-H3: background control, Nup2: positive control. Below: Proximity signals. n = 3 replicates per sample except when indicated differently. Ratios are log2-transformed. Black lines indicate average proximity signal. Proximity signals that differ significantly from background are marked in green (q 0.01) filled circles. Grey filled triangles: q > 0.05. N: N-terminal HKMTmyc fusion. Image collected and cropped by CiteAb from the following publication (https://biosignaling.biomedcentral.com/articles/10.1186/s12964-019-0381-z), licensed under a CC-BY licence.
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Analysis of Histone H3 K9-me3 in HeLa histone lysates. Observed molecular weight is ~15 kDa.
(2 Reviews)
(24 Publications)
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
DPEP2 Antibody
NBP2-82910
DPEP2 Antibody
Species: Hu
Applications: WB

Publications for DPEP2 Antibody (NBP2-82910) (0)

There are no publications for DPEP2 Antibody (NBP2-82910).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPEP2 Antibody (NBP2-82910) (0)

There are no reviews for DPEP2 Antibody (NBP2-82910). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DPEP2 Antibody (NBP2-82910) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DPEP2 Products

Bioinformatics Tool for DPEP2 Antibody (NBP2-82910)

Discover related pathways, diseases and genes to DPEP2 Antibody (NBP2-82910). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPEP2 Antibody (NBP2-82910)

Discover more about diseases related to DPEP2 Antibody (NBP2-82910).
 

Pathways for DPEP2 Antibody (NBP2-82910)

View related products by pathway.

PTMs for DPEP2 Antibody (NBP2-82910)

Learn more about PTMs related to DPEP2 Antibody (NBP2-82910).
 

Research Areas for DPEP2 Antibody (NBP2-82910)

Find related products by research area.

Blogs on DPEP2

There are no specific blogs for DPEP2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DPEP2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol DPEP2