DPEP2 Antibody


Western Blot: DPEP2 Antibody [NBP2-82910] - Host: Rabbit. Target Name: DPEP2. Sample Type: OVCAR-3 Whole Cell lysates. Antibody Dilution: 1.0ug/mlDPEP2 is supported by BioGPS gene expression data to be expressed in ...read more

Product Details

Reactivity HuSpecies Glossary
Applications WB
0.5 mg/ml

Order Details

DPEP2 Antibody Summary

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DPEP2. Peptide sequence: VFRQVEKVQEENKWQSPLEDKFPDEQLSSSCHSDLSRLRQRQSLTSGQEL The peptide sequence for this immunogen was taken from within the described region.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
0.5 mg/ml
Affinity purified

Alternate Names for DPEP2 Antibody

  • dipeptidase 2
  • EC
  • MBD2


DPEP2 belongs to the membrane-bound dipeptidase (EC family. These enzymes hydrolyze a variety of dipeptides, including leukotriene D4, the beta-lactam ring of some antibiotics, and cystinyl-bis-glycine (cys-bis-gly) formed during glutathione degradation (Habib et al., 2003 [PubMed 12738806]).[supplied by OMIM]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu(-)
Applications: ICC/IF, IHC, IHC-P, WB (-)
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, CyTOF-ready, Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ChIP, IHC, IHC-P, KD, Simple Western, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ChIP, ICC/IF, IHC, IP, WB
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu
Applications: WB

Publications for DPEP2 Antibody (NBP2-82910) (0)

There are no publications for DPEP2 Antibody (NBP2-82910).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPEP2 Antibody (NBP2-82910) (0)

There are no reviews for DPEP2 Antibody (NBP2-82910). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DPEP2 Antibody (NBP2-82910) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DPEP2 Products

Diseases for DPEP2 Antibody (NBP2-82910)

Discover more about diseases related to DPEP2 Antibody (NBP2-82910).

Pathways for DPEP2 Antibody (NBP2-82910)

View related products by pathway.

PTMs for DPEP2 Antibody (NBP2-82910)

Learn more about PTMs related to DPEP2 Antibody (NBP2-82910).

Research Areas for DPEP2 Antibody (NBP2-82910)

Find related products by research area.

Blogs on DPEP2

There are no specific blogs for DPEP2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DPEP2 Antibody and receive a gift card or discount.


Gene Symbol DPEP2