Dopamine Receptor D4 Antibody - BSA Free

Western Blot: Dopamine Receptor D4 Antibody [NBP2-92717] - Analysis of extracts of various cell lines, using Dopamine Receptor D4 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.

Immunohistochemistry-Paraffin: Dopamine Receptor D4 Antibody [NBP2-92717] - Paraffin-embedded rat retina using Dopamine Receptor D4 .

• Reactivity: Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Dopamine Receptor D4 Antibody - BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human DRD4 (NP_000788.2). AWLLSPRLCDALMAMDVMLCTASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGRDPAVCRLEDRDYVVYSSVCS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DRD4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:1000
• Theoretical MW: 44 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Dopamine Receptor D4 Antibody - BSA Free

• D(2C) dopamine receptor
• D(4) dopamine receptor
• D4DR
• Dopamine D4 receptor
• Dopamine Receptor D4
• DRD4
• seven transmembrane helix receptor

Background

DRD4, a Dopamine Receptor, has been suggested to affect personality, substance dependence, cognition, and emotion. DRD4 binds the antipsychotic medications clozapine and spiperone. DRD4 knock-out mice are anatomically normal but display altered locomotion and sensitivity to drugs such as clozapine, cocaine, and others. The DRD4 gene contains extensive polymorphisms consisting of variable numbers of tandem repeats (VNTR) in sequences corresponding to the third cytoplasmic loop of the receptor; at least 27 different haplotypes encoding 20 different protein variants have been documented. The frequency of the different variants varies among population groups. Studies have suggested a link between VNTR and human personality traits (such as novelty seeking) and diseases (such as schizophrenia, bipolar affective disorder, and Tourette syndrome); however, considerable debates exist regarding the validity and significance of such associations. DRD4 expression has been reported in various regions of the brain as well as in adrenal gland, artery, eye, heart, kidney, placenta, spinal cord, testis, and vas deferens. ESTs have been isolated from a kidney library.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Dopamine Receptor D4 Antibody (NBP2-92717)(1)

Publication using NBP2-92717

• Gao P, Liu X, Zhu T et al. Vital function of DRD4 in dapoxetine medicated premature ejaculation treatment Andrology 2023-02-06 [PMID: 36746766] (WB)

Bioinformatics

• Gene Symbol: DRD4