Dopamine D1R/DRD1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Dopamine D1R/DRD1 Source: E. coli
Amino Acid Sequence: FRKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHP Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
DRD1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17644. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Dopamine D1R/DRD1 Recombinant Protein Antigen
Background
The members of the G protein-coupled receptor family are distinguished by their slow transmitting response to ligand binding. These seven transmembrane proteins include the adrenergic, serotonin, and dopamine receptors. The effect of the signaling molecule can be excitatory or inhibitory depending on the type of receptor to which it binds. Beta-adrenergic receptor bound to adrenaline activates adenylyl cyclase, while alpha 2-adrenergic receptor bound to adrenaline inhibits adenylyl cyclase. The dopamine receptors are divided into two classes; D1 and D2, which differ in their functional characteristics. D1 receptors stimulate adenylyl cyclase, while D2 receptors inhibit adenylyl cyclase activity. Five different subtypes of dopamine receptor have been described to date. D1DR and D5DR belong to the D1 subclass, while D2DR, D3DR and D4DR belong to the D2 subclass of dopamine receptors.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, Func, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: DB, ELISA, ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: IHC
Species: Hu, Rt
Applications: IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu, Mu, Rt
Applications: ELISA
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ELISA
Species: Ca, Gp, Hu, Mu, Po, Rb, Rt, Sh
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: AC
Publications for Dopamine D1R/DRD1 Recombinant Protein Antigen (NBP3-17644PEP) (0)
There are no publications for Dopamine D1R/DRD1 Recombinant Protein Antigen (NBP3-17644PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Dopamine D1R/DRD1 Recombinant Protein Antigen (NBP3-17644PEP) (0)
There are no reviews for Dopamine D1R/DRD1 Recombinant Protein Antigen (NBP3-17644PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Dopamine D1R/DRD1 Recombinant Protein Antigen (NBP3-17644PEP) (0)
Additional Dopamine D1R/DRD1 Products
Research Areas for Dopamine D1R/DRD1 Recombinant Protein Antigen (NBP3-17644PEP)
Find related products by research area.
|
Blogs on Dopamine D1R/DRD1