Dopamine D1R/DRD1 Recombinant Protein Antigen

Images

 
There are currently no images for Dopamine D1R/DRD1 Recombinant Protein Antigen (NBP3-17644PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Dopamine D1R/DRD1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Dopamine D1R/DRD1

Source: E. coli

Amino Acid Sequence: FRKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DRD1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17644.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Dopamine D1R/DRD1 Recombinant Protein Antigen

  • D(1A) dopamine receptor
  • D1DR
  • DADR
  • Dopamine D1 R
  • Dopamine D1 receptor
  • Dopamine D1R
  • dopamine receptor D1
  • DRD1
  • DRD1A

Background

The members of the G protein-coupled receptor family are distinguished by their slow transmitting response to ligand binding. These seven transmembrane proteins include the adrenergic, serotonin, and dopamine receptors. The effect of the signaling molecule can be excitatory or inhibitory depending on the type of receptor to which it binds. Beta-adrenergic receptor bound to adrenaline activates adenylyl cyclase, while alpha 2-adrenergic receptor bound to adrenaline inhibits adenylyl cyclase. The dopamine receptors are divided into two classes; D1 and D2, which differ in their functional characteristics. D1 receptors stimulate adenylyl cyclase, while D2 receptors inhibit adenylyl cyclase activity. Five different subtypes of dopamine receptor have been described to date. D1DR and D5DR belong to the D1 subclass, while D2DR, D3DR and D4DR belong to the D2 subclass of dopamine receptors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-25443
Species: Hu, Mu, Rt
Applications: Func, ICC/IF, IHC, IHC-P, WB
NBP1-87757
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-00178
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
NBP3-12391
Species: Hu, Mu, Rt
Applications: DB, ELISA, ICC/IF, IP, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-22164
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NLS3921
Species: Hu, Pm, Pm
Applications: IHC, IHC-P
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
MAB4230
Species: Mu, Rt
Applications: IHC, WB
MAB8286
Species: Hu
Applications: IHC
NB100-1780
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
DBD00
Species: Hu
Applications: ELISA
NBP1-39474
Species: Ca, Gp, Hu, Mu, Po, Rb, Rt, Sh
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP3-17644PEP
Species: Hu
Applications: AC

Publications for Dopamine D1R/DRD1 Recombinant Protein Antigen (NBP3-17644PEP) (0)

There are no publications for Dopamine D1R/DRD1 Recombinant Protein Antigen (NBP3-17644PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dopamine D1R/DRD1 Recombinant Protein Antigen (NBP3-17644PEP) (0)

There are no reviews for Dopamine D1R/DRD1 Recombinant Protein Antigen (NBP3-17644PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Dopamine D1R/DRD1 Recombinant Protein Antigen (NBP3-17644PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dopamine D1R/DRD1 Products

Research Areas for Dopamine D1R/DRD1 Recombinant Protein Antigen (NBP3-17644PEP)

Find related products by research area.

Blogs on Dopamine D1R/DRD1

There are no specific blogs for Dopamine D1R/DRD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Dopamine D1R/DRD1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DRD1