DONSON Antibody

Images

 
Immunohistochemistry: DONSON Antibody [NBP2-13931] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DONSON Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VDWSIKTRLLFTSSQPFTWADHLKAQEEAQGLVQHCRATEVTLPKSIQDP KLSSELRCTFQQSLIYWLHPALSWLPLFPRIG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DONSON
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DONSON Protein (NBP2-13931PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DONSON Antibody

  • B17
  • downstream neighbor of SON
  • protein downstream neighbor of Son

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-53281
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-88933
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33626
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88936
Species: Hu
Applications: IHC, IHC-P
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88938
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88941
Species: Hu
Applications: IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB5756
Species: Hu
Applications: Flow
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-13931
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for DONSON Antibody (NBP2-13931) (0)

There are no publications for DONSON Antibody (NBP2-13931).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DONSON Antibody (NBP2-13931) (0)

There are no reviews for DONSON Antibody (NBP2-13931). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DONSON Antibody (NBP2-13931) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DONSON Products

Bioinformatics Tool for DONSON Antibody (NBP2-13931)

Discover related pathways, diseases and genes to DONSON Antibody (NBP2-13931). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for DONSON Antibody (NBP2-13931)

View related products by pathway.

Blogs on DONSON

There are no specific blogs for DONSON, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DONSON Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DONSON