DOK6 Antibody

Images

 
Immunohistochemistry: DOK6 Antibody [NBP2-32609] - Staining of cerebellum.
Immunohistochemistry: DOK6 Antibody [NBP2-32609] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemistry: DOK6 Antibody [NBP2-32609] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemistry: DOK6 Antibody [NBP2-32609] - Staining of lymphoma.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DOK6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: WHHITRQNSVGEIYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLIQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DOK6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DOK6 Protein (NBP2-32609PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DOK6 Antibody

  • docking protein 5-like
  • docking protein 6
  • DOK5L
  • Downstream of tyrosine kinase 6
  • HsT3226
  • MGC20785

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF482
Species: Mu
Applications: WB, IHC
AF1404
Species: Mu, Rt
Applications: WB, Simple Western, IHC, Block
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02073
Species: Hu, Mu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00000420-B01P
Species: Hu
Applications: WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB100-82112
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87382
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87832
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
AF746
Species: Hu, Mu
Applications: WB
NBP2-32609
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for DOK6 Antibody (NBP2-32609) (0)

There are no publications for DOK6 Antibody (NBP2-32609).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DOK6 Antibody (NBP2-32609) (0)

There are no reviews for DOK6 Antibody (NBP2-32609). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DOK6 Antibody (NBP2-32609) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DOK6 Products

Bioinformatics Tool for DOK6 Antibody (NBP2-32609)

Discover related pathways, diseases and genes to DOK6 Antibody (NBP2-32609). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DOK6 Antibody (NBP2-32609)

Discover more about diseases related to DOK6 Antibody (NBP2-32609).
 

Pathways for DOK6 Antibody (NBP2-32609)

View related products by pathway.

PTMs for DOK6 Antibody (NBP2-32609)

Learn more about PTMs related to DOK6 Antibody (NBP2-32609).

Blogs on DOK6

There are no specific blogs for DOK6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DOK6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DOK6