DOK1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DOK1 Antibody [NBP2-55613] - Staining of human cell line A-431 shows localization to cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DOK1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AQGNDIFQAVETAIHRQKAQGKAGQGHDVLRADSHEGEVAEGKLPSPPGPQELLDSPPALYAEPLDSLRIAPCPSQDSLYSDPLDSTSAQAGEGVQRKKPLYWDLYEHAQQQLLKAKLTDPKEDPIYDEPEG
Specificity
Specificity of human DOK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DOK1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DOK1 Recombinant Protein Antigen (NBP2-55613PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for DOK1 Antibody

  • docking protein 1 (downstream of tyrosine kinase 1)
  • docking protein 1
  • docking protein 1, 62kD (downstream of tyrosine kinase 1)
  • docking protein 1, 62kDa (downstream of tyrosine kinase 1)
  • Downstream of tyrosine kinase 1
  • MGC117395
  • MGC138860
  • p62(dok)
  • P62DOK
  • pp62

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38645
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-48320
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5094
Species: Hu, Mu, Rt
Applications: WB
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-00948
Species: Hu
Applications: WB, Flow, ICC/IF
AF5414
Species: Hu
Applications: WB, Simple Western
NBP2-75585
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB2317
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
NBP2-25200
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr, B/N

Publications for DOK1 Antibody (NBP2-55613) (0)

There are no publications for DOK1 Antibody (NBP2-55613).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DOK1 Antibody (NBP2-55613) (0)

There are no reviews for DOK1 Antibody (NBP2-55613). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DOK1 Antibody (NBP2-55613) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for DOK1 Antibody (NBP2-55613)

Discover related pathways, diseases and genes to DOK1 Antibody (NBP2-55613). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DOK1 Antibody (NBP2-55613)

Discover more about diseases related to DOK1 Antibody (NBP2-55613).
 

Pathways for DOK1 Antibody (NBP2-55613)

View related products by pathway.

PTMs for DOK1 Antibody (NBP2-55613)

Learn more about PTMs related to DOK1 Antibody (NBP2-55613).
 

Research Areas for DOK1 Antibody (NBP2-55613)

Find related products by research area.

Blogs on DOK1

There are no specific blogs for DOK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DOK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DOK1