DOCK4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DOCK4 Antibody [NBP2-57555] - Staining of human cell line PC-3 shows localization to nucleoli, plasma membrane & cytosol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DOCK4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CSAIYPTPVEPSQRMLFNHIGDGALPRSDPNLSAPEKAVNPTPSSWSLDSGKEAKNMSDSGKLISP
Specificity
Specificity of human DOCK4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DOCK4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DOCK4 Recombinant Protein Antigen (NBP2-57555PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for DOCK4 Antibody

  • dedicator of cytokinesis 4
  • dedicator of cytokinesis protein 4
  • KIAA0716FLJ34238
  • MGC134911
  • MGC134912

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-30945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-93647
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-85702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF1555
Species: Hu
Applications: WB
NBP2-22527
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-89189
Species: Hu, Mu
Applications: IHC, IHC-P
H00006598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-21065
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for DOCK4 Antibody (NBP2-57555) (0)

There are no publications for DOCK4 Antibody (NBP2-57555).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DOCK4 Antibody (NBP2-57555) (0)

There are no reviews for DOCK4 Antibody (NBP2-57555). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DOCK4 Antibody (NBP2-57555) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for DOCK4 Antibody (NBP2-57555)

Discover related pathways, diseases and genes to DOCK4 Antibody (NBP2-57555). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DOCK4 Antibody (NBP2-57555)

Discover more about diseases related to DOCK4 Antibody (NBP2-57555).
 

Pathways for DOCK4 Antibody (NBP2-57555)

View related products by pathway.

PTMs for DOCK4 Antibody (NBP2-57555)

Learn more about PTMs related to DOCK4 Antibody (NBP2-57555).

Blogs on DOCK4

There are no specific blogs for DOCK4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DOCK4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DOCK4