DNASE2B Antibody


Western Blot: DNASE2B Antibody [NBP1-62279] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

DNASE2B Antibody Summary

Synthetic peptides corresponding to DNASE2B(deoxyribonuclease II beta) The peptide sequence was selected from the middle region of DNASE2B. Peptide sequence IKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DNASE2B and was validated on Western blot.
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DNASE2B Antibody

  • deoxyribonuclease II betaDNase2-like acid DNase
  • DLADdeoxyribonuclease-2-beta
  • DNase II beta
  • DNase II-like acid DNase
  • EC
  • Endonuclease DLAD
  • lysosomal DNase II


DNASE2B shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this protein is restricted to the salivary gland and lungs. The protein encoded by this gene shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this gene product is restricted to the salivary gland and lungs. The gene has been localized to chromosome 1p22.3 adjacent (and in opposite orientation) to the uricase pseudogene. Two transcript variants encoding different isoforms have been described for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Mu
Applications: WB, IHC, IP
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
Species: Ba
Applications: WB, ELISA, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB

Publications for DNASE2B Antibody (NBP1-62279) (0)

There are no publications for DNASE2B Antibody (NBP1-62279).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNASE2B Antibody (NBP1-62279) (0)

There are no reviews for DNASE2B Antibody (NBP1-62279). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNASE2B Antibody (NBP1-62279) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DNASE2B Products

Bioinformatics Tool for DNASE2B Antibody (NBP1-62279)

Discover related pathways, diseases and genes to DNASE2B Antibody (NBP1-62279). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNASE2B Antibody (NBP1-62279)

Discover more about diseases related to DNASE2B Antibody (NBP1-62279).

Blogs on DNASE2B

There are no specific blogs for DNASE2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DNASE2B Antibody and receive a gift card or discount.


Gene Symbol DNASE2B