DNAJC15 Antibody - BSA Free

Western Blot: DNAJC15 Antibody [NBP2-86618] - Host: Rabbit. Target Name: DNAJC15. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

DNAJC15 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DNAJC15 Antibody - BSA Free (NBP2-86618) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human DNAJC15. Peptide sequence: FAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLIL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DNAJC15
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for DNAJC15 Antibody - BSA Free

• Cell growth-inhibiting gene 22 protein
• DnaJ (Hsp40) homolog, subfamily C, member 15
• DnaJ (Hsp40) homolog, subfamily D, member 1
• DNAJ domain-containing
• dnaJ homolog subfamily C member 15
• DNAJD1
• MCJHSD18
• Methylation-controlled J protein

Background

DNAJD1( AAH10910, 1 a.a. - 151 a.a.) full-length recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DNAJC15