| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse DNAJC15 Antibody - Azide and BSA Free (H00029103-B01P) is a polyclonal antibody validated for use in WB. Anti-DNAJC15 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | DNAJC15 (NP_037370, 1 a.a. - 150 a.a.) full-length human protein. MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQRLVRSLIAVGLGVAALAFAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | DNAJC15 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This antibody is useful for Western Blot, Functional |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
| Publication using H00029103-B01P | Applications | Species |
|---|---|---|
| Anna K, Andreas S, Alexandra H et al. Interrogation of cancer gene dependencies reveals paralog interactions of autosome and sex chromosome-encoded genes. Cell Rep. 2022-04-12 [PMID: 35417719] |
Secondary Antibodies |
Isotype Controls |
Research Areas for DNAJC15 Antibody (H00029103-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.