DNAJC15 Antibody

Images

 
Western Blot: DNAJC15 Antibody [H00029103-B01P] - Analysis of DNAJC15 expression in transfected 293T cell line by DNAJC15 polyclonal antibody. Lane 1: DNAJC15 transfected lysate(16.5 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DNAJC15 Antibody Summary

Immunogen
DNAJC15 (NP_037370, 1 a.a. - 150 a.a.) full-length human protein. MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQRLVRSLIAVGLGVAALAFAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
DNAJC15
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is useful for Western Blot, Functional

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DNAJC15 Antibody

  • Cell growth-inhibiting gene 22 protein
  • DnaJ (Hsp40) homolog, subfamily C, member 15
  • DnaJ (Hsp40) homolog, subfamily D, member 1
  • DNAJ domain-containing
  • dnaJ homolog subfamily C member 15
  • DNAJD1
  • MCJHSD18
  • Methylation-controlled J protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010049-M01
Species: Hu
Applications: ELISA, ICC/IF (-), IHC, WB
NBP2-02996
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-29429
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single-Cell Western, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-16020
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-50030
Species: Bv, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
DTSP10
Species: Hu
Applications: ELISA
AF1056
Species: Rt
Applications: IHC, WB
NBP2-03644
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-2727
Species: Ca, Hu, Po, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB100-56104
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP1-32448
Species: Hu
Applications: ICC/IF, WB
NBP1-87528
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56519
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-03433
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for DNAJC15 Antibody (H00029103-B01P) (0)

There are no publications for DNAJC15 Antibody (H00029103-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAJC15 Antibody (H00029103-B01P) (0)

There are no reviews for DNAJC15 Antibody (H00029103-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNAJC15 Antibody (H00029103-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNAJC15 Products

Bioinformatics Tool for DNAJC15 Antibody (H00029103-B01P)

Discover related pathways, diseases and genes to DNAJC15 Antibody (H00029103-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAJC15 Antibody (H00029103-B01P)

Discover more about diseases related to DNAJC15 Antibody (H00029103-B01P).
 

Pathways for DNAJC15 Antibody (H00029103-B01P)

View related products by pathway.

PTMs for DNAJC15 Antibody (H00029103-B01P)

Learn more about PTMs related to DNAJC15 Antibody (H00029103-B01P).
 

Research Areas for DNAJC15 Antibody (H00029103-B01P)

Find related products by research area.

Blogs on DNAJC15

There are no specific blogs for DNAJC15, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAJC15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJC15
Uniprot