DNAJC14 Antibody

Images

 
Western Blot: DNAJC14 Antibody [NBP1-90488] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: DNAJC14 Antibody [NBP1-90488] - Staining of human stomach shows cytoplasmic positivity in glandular cells. Parietal cells show strong staining.
Western Blot: DNAJC14 Antibody [NBP1-90488] - Analysis in human cell line EFO-21.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNAJC14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WGWLELPWVKQNINRQGNAPVASGRYCQPEEEVARLLTMAGVPEDELNPFHVLGVEATASDVELKKAYRQLAVMVHPDKNHHPRAEEAFKVLRAAWDIVSNAEKRKEYEMKRMAENELSRSVNEFLSKLQDDLKEAMNTMMCSRCQG
Specificity
Specificity of human DNAJC14 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAJC14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200-1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
DNAJC14 Knockout HeLa Cell Lysate
Control Peptide
Publications
Read Publications using NBP1-90488.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22915803)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNAJC14 Antibody

  • DnaJ (Hsp40) homolog, subfamily C, member 14
  • dnaJ homolog subfamily C member 14
  • dnaJ protein homolog 3
  • dopamine receptor interacting protein
  • dopamine receptor-interacting protein of 78 kDa
  • HDJ3
  • hDj-3
  • human DnaJ protein 3
  • LIP6
  • LYST-interacting protein LIP6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-77397
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, KD
NBP2-16890
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2788
Species: Hu, Mu, Rt, Bv, Fe, Fi, Ha, Pm
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
NBP1-88019
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-06274
Species: Hu, Mu, Rt, Ce, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IHC-FrFl
NBP1-33387
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1543
Species: Hu
Applications: WB, IHC
H00010049-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-83703
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00008706-T01
Species: Hu
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-90824
Species: Hu
Applications: WB, ICC/IF
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-90488
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for DNAJC14 Antibody (NBP1-90488)(2)

Reviews for DNAJC14 Antibody (NBP1-90488) (0)

There are no reviews for DNAJC14 Antibody (NBP1-90488). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNAJC14 Antibody (NBP1-90488) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DNAJC14 Products

Bioinformatics Tool for DNAJC14 Antibody (NBP1-90488)

Discover related pathways, diseases and genes to DNAJC14 Antibody (NBP1-90488). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAJC14 Antibody (NBP1-90488)

Discover more about diseases related to DNAJC14 Antibody (NBP1-90488).
 

Pathways for DNAJC14 Antibody (NBP1-90488)

View related products by pathway.

PTMs for DNAJC14 Antibody (NBP1-90488)

Learn more about PTMs related to DNAJC14 Antibody (NBP1-90488).

Blogs on DNAJC14

There are no specific blogs for DNAJC14, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAJC14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJC14
COVID-19 update