DNAJC10 Antibody (3A8)

Images

 
Western Blot: DNAJC10 Antibody (3A8) [H00054431-M02] - DNAJC10 monoclonal antibody (M02), clone 3A8. Analysis of DNAJC10 expression in NIH/3T3.
Western Blot: DNAJC10 Antibody (3A8) [H00054431-M02] - DNAJC10 monoclonal antibody (M02), clone 3A8. Analysis of DNAJC10 expression in HeLa.
Western Blot: DNAJC10 Antibody (3A8) [H00054431-M02] - DNAJC10 monoclonal antibody (M02), clone 3A8. Analysis of DNAJC10 expression in PC-12.
Western Blot: DNAJC10 Antibody (3A8) [H00054431-M02] - DNAJC10 monoclonal antibody (M02), clone 3A8. Analysis of DNAJC10 expression in Raw 264.7.
Western Blot: DNAJC10 Antibody (3A8) [H00054431-M02] - DNAJC10 monoclonal antibody (M02), clone 3A8. Analysis of DNAJC10 expression in human kidney.
Sandwich ELISA: DNAJC10 Antibody (3A8) [H00054431-M02] - Detection limit for recombinant GST tagged DNAJC10 is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3A8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DNAJC10 Antibody (3A8) Summary

Immunogen
DNAJC10 (NP_061854, 688 a.a. ~ 793 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KNHWVIDFYAPWCGPCQNFAPEFELLARMIKGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTRDAKAIAALISEKLETLRNQGKRNKDEL
Specificity
DNAJC10 - DnaJ (Hsp40) homolog, subfamily C, member 10 (3A8)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DNAJC10
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DNAJC10 Antibody (3A8)

  • DKFZp434J1813
  • DnaJ (Hsp40) homolog, subfamily C, member 10
  • dnaJ homolog subfamily C member 10
  • ERdj5
  • ER-resident protein ERdj5
  • J-domain-containing protein disulfide isomerase-like protein
  • JPDI
  • macrothioredoxin
  • MGC104194
  • MTHr

Background

This endoplasmic reticulum co-chaperone may play a role in protein folding and translocation across the endoplasmic reticulum membrane. May act as a co-chaperone for HSPA5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
AF1543
Species: Hu
Applications: IHC, WB
NBP1-84905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02996
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00010049-M01
Species: Hu
Applications: ELISA, ICC/IF (-), IHC, WB
NBP1-87201
Species: Hu
Applications: IHC, IHC-P, WB
NB100-1965
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-519
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-84796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP2-93746
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-77681
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
NB300-517
Species: Bv, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1921
Species: Bv, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-78785
Species: Hu, Mu
Applications: Flow, ICC/IF, PEP-ELISA, WB
H00054431-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, S-ELISA

Publications for DNAJC10 Antibody (H00054431-M02) (0)

There are no publications for DNAJC10 Antibody (H00054431-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAJC10 Antibody (H00054431-M02) (0)

There are no reviews for DNAJC10 Antibody (H00054431-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNAJC10 Antibody (H00054431-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNAJC10 Products

Bioinformatics Tool for DNAJC10 Antibody (H00054431-M02)

Discover related pathways, diseases and genes to DNAJC10 Antibody (H00054431-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAJC10 Antibody (H00054431-M02)

Discover more about diseases related to DNAJC10 Antibody (H00054431-M02).
 

Pathways for DNAJC10 Antibody (H00054431-M02)

View related products by pathway.

PTMs for DNAJC10 Antibody (H00054431-M02)

Learn more about PTMs related to DNAJC10 Antibody (H00054431-M02).
 

Research Areas for DNAJC10 Antibody (H00054431-M02)

Find related products by research area.

Blogs on DNAJC10

There are no specific blogs for DNAJC10, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAJC10 Antibody (3A8) and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJC10
Entrez
Uniprot