DNAJB12 Antibody - BSA Free

Western Blot: DNAJB12 Antibody [NBP2-87285] - WB Suggested Anti-Dnajb12 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Mouse Small Intestine

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

DNAJB12 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DNAJB12 Antibody - BSA Free (NBP2-87285) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse DNAJB12. Peptide sequence: NQKPQSTGDHPQPTDTTHTTTKKAGGTETPSANGEAGGGESAKGYTSEQV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DNAJB12
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for DNAJB12 Antibody - BSA Free

• DJ10FLJ20027
• DKFZp586B2023
• DnaJ (Hsp40) homolog, subfamily B, member 12
• dnaJ homolog subfamily B member 12
• FLJ0027

Background

DNAJB12, also known as DnaJ homolog subfamily B member 12, consists of a 41.8 kDa and a 42.3 kDa isoform and is involved in stimulating ATPase in order to regulate molecular chaperone activity as a part of the DNAJ/HSP40 family. Diseases and disorders such as malaria, fundus dystrophy, choroiditis, choroideremia, and cone-rod dystrophy have been studied with the protein. The protein acts in the protein processing pathway in the endoplasmic reticulum along with MME, MYC, HSPA2, TNFRSF1A, and WIPI2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DNAJB12