DNA polymerase mu Antibody - BSA Free

Western Blot: DNA polymerase mu Antibody [NBP2-57664] - Western blot analysis in human cell line RT-4.

Immunocytochemistry/Immunofluorescence: DNA polymerase mu Antibody [NBP2-57664] - Staining of human cell line U-251 MG shows localization to nucleus & cytosol.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DNA polymerase mu Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SEATHVVMEETSAEEAVSWQERRMAAAPPGCTPPALLDISWLTESLGAGQPVPVECRHRLEVAGPRKGPLSPAWMPAYACQRPTPLTHHNTG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POLM
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DNA polymerase mu Recombinant Protein Antigen (NBP2-57664PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DNA polymerase mu Antibody - BSA Free

• DNA polymerase mu
• DNA-directed DNA/RNA polymerase mu
• EC 2.7.7.7
• FLJ35482
• Pol iota
• Pol Mu
• polmu
• polymerase (DNA directed), mu
• polymerase (DNA-directed), mu
• Tdt-N
• Terminal transferase

Background

Seems to act as an Ig mutase which is responsible for immunoglobulin (Ig) gene hypermutation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POLM