DNA polymerase delta p50 Antibody

Images

 
Western Blot: DNA polymerase delta p50 Antibody [NBP1-58097] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNA polymerase delta p50 Antibody Summary

Immunogen
Synthetic peptides corresponding to POLD2(polymerase (DNA directed), delta 2, regulatory subunit 50kDa) The peptide sequence was selected from the N terminal of POLD2. Peptide sequence LREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGT.
Specificity
This product is specific to Subunit or Isoform: 2.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POLD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against POLD2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DNA polymerase delta p50 Antibody

  • delta 2, regulatory subunit (50kD)
  • polymerase (DNA directed), delta 2, regulatory subunit 50kDa

Background

This protein is a DNA polymerase delta complex,it involved in DNA replication and repair, and it consists of the proliferating cell nuclear antigen, the multisubunit replication factor C, and the 4 subunit polymerase complex: POLD1, POLD2, POLD3, and POLD4The DNA polymerase delta complex is involved in DNA replication and repair, and it consists of the proliferating cell nuclear antigen (PCNA; MIM 176740), the multisubunit replication factor C (see MIM 102579), and the 4 subunit polymerase complex: POLD1 (MIM 174761), POLD2, POLD3 (MIM 611415), and POLD4 (MIM 611525) (Liu and Warbrick, 2006 [PubMed 16934752]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-477
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81341
Species: Hu
Applications: WB, IHC, IHC-P
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KD
NBP2-16182
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-52983
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01407
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-19939
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, ChIP
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-75717
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF3926
Species: Hu, Mu, Rt
Applications: WB
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
DDX0130P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-P
NB600-302
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC

Publications for DNA polymerase delta p50 Antibody (NBP1-58097) (0)

There are no publications for DNA polymerase delta p50 Antibody (NBP1-58097).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA polymerase delta p50 Antibody (NBP1-58097) (0)

There are no reviews for DNA polymerase delta p50 Antibody (NBP1-58097). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNA polymerase delta p50 Antibody (NBP1-58097) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DNA polymerase delta p50 Products

Bioinformatics Tool for DNA polymerase delta p50 Antibody (NBP1-58097)

Discover related pathways, diseases and genes to DNA polymerase delta p50 Antibody (NBP1-58097). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNA polymerase delta p50 Antibody (NBP1-58097)

Discover more about diseases related to DNA polymerase delta p50 Antibody (NBP1-58097).
 

Pathways for DNA polymerase delta p50 Antibody (NBP1-58097)

View related products by pathway.

PTMs for DNA polymerase delta p50 Antibody (NBP1-58097)

Learn more about PTMs related to DNA polymerase delta p50 Antibody (NBP1-58097).
 

Research Areas for DNA polymerase delta p50 Antibody (NBP1-58097)

Find related products by research area.

Blogs on DNA polymerase delta p50

There are no specific blogs for DNA polymerase delta p50, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNA polymerase delta p50 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POLD2
Uniprot
COVID-19 update