DMPK Antibody

Images

 
Immunohistochemistry-Paraffin: DMPK Antibody [NBP1-85011] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DMPK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SDIREGAPLGVHLPFVGYSYSCMALRDSEVPGPTPMELEAEQLLEPHVQAPSLEPSVSPQDETAEVAVPAAVPAAEAEAEVTLRELQEALEEEVLTRQSLSREMEAIRTDNQNFASQLREAEARNRDLEAHVRQLQERME
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DMPK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DMPK Protein (NBP1-85011PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DMPK Antibody

  • DM1
  • DM1PK
  • DMK
  • DMKEC 2.7.11.1
  • DM-kinase
  • DMmyotonin protein kinase A
  • DMPK
  • dystrophia myotonica-protein kinase
  • MDPK
  • MDPKDM protein kinase
  • MT-PK
  • MT-PKmyotonic dystrophy associated protein kinase
  • Myotonic dystrophy protein kinase
  • myotonin-protein kinase
  • thymopoietin homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-12553
Species: Hu
NBP2-42632
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB110-37256
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-04611
Species: Hu
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB38461
Species: Hu
Applications: WB, IHC
H00347527-B01P
Species: Hu
Applications: WB, ELISA
NB200-316
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb
Applications: WB, Simple Western, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-86562
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DMPK Antibody (NBP1-85011) (0)

There are no publications for DMPK Antibody (NBP1-85011).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DMPK Antibody (NBP1-85011) (0)

There are no reviews for DMPK Antibody (NBP1-85011). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DMPK Antibody (NBP1-85011) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DMPK Products

Bioinformatics Tool for DMPK Antibody (NBP1-85011)

Discover related pathways, diseases and genes to DMPK Antibody (NBP1-85011). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DMPK Antibody (NBP1-85011)

Discover more about diseases related to DMPK Antibody (NBP1-85011).
 

Pathways for DMPK Antibody (NBP1-85011)

View related products by pathway.

PTMs for DMPK Antibody (NBP1-85011)

Learn more about PTMs related to DMPK Antibody (NBP1-85011).
 

Research Areas for DMPK Antibody (NBP1-85011)

Find related products by research area.

Blogs on DMPK

There are no specific blogs for DMPK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DMPK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DMPK
Entrez