DMP-1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit DMP-1 Antibody - BSA Free (NBP1-89484) is a polyclonal antibody validated for use in IHC. Anti-DMP-1 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: QYIYRLAGGFSRSTGKGGDDKDDDEDDSGDDTFGDDDSGPGPKDRQEGGNSRLGSDEDSDDTIQASEESAPQGQDSAQDTTSE |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DMP1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for DMP-1 Antibody - BSA Free
Background
Dentin matrix acidic phosphoprotein is an extracellular matrix protein and a member of the small integrin binding ligand N-linked glycoprotein family. This protein, which is critical for proper mineralization of bone and dentin, is present in diverse cells of bone and tooth tissues. The protein contains a large number of acidic domains, multiple phosphorylation sites, a functional arg-gly-asp cell attachment sequence, and a DNA binding domain. In undifferentiated osteoblasts it is primarily a nuclear protein that regulates the expression of osteoblast-specific genes. During osteoblast maturation the protein becomes phosphorylated and is exported to the extracellular matrix, where it orchestrates mineralized matrix formation. Mutations in the gene are known to cause autosomal recessive hypophosphatemia, a disease that manifests as rickets and osteomalacia. The gene structure is conserved in mammals. Two transcript variants encoding different isoforms have been described for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
Species: Hu
Applications: BA
Species: Mu
Applications: IHC
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: EnzAct
Species: Mu
Applications: WB
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
Species: Hu, Mu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: IHC, WB
Publications for DMP-1 Antibody (NBP1-89484)(3)
Showing Publications 1 -
3 of 3.
| Publications using NBP1-89484 |
Applications |
Species |
| Zheng X, Huang H, Zhou Z et Al. Axin1 regulates tooth root development by inhibiting AKT1-mTORC1 activation and Shh translation in Hertwig's epithelial root sheath Development 2024-10-30 [PMID: 39344774] |
|
|
| Yang S, Leung AYP, Wang Z et Al. Proanthocyanidin surface preconditioning of dental pulp stem cell spheroids enhances dimensional stability and biomineralization in vitro Int Endod J 2024-10-10 [PMID: 39046812] |
|
|
| Shunsuke Kawai, Junko Sunaga, Sanae Nagata, Megumi Nishio, Masayuki Fukuda, Takeshi Kamakura, Liping Sun, Yonghui Jin, Satoko Sakamoto, Akira Watanabe, Shuichi Matsuda, Taiji Adachi, Junya Toguchida 3D osteogenic differentiation of human iPSCs reveals the role of TGF beta signal in the transition from progenitors to osteoblasts and osteoblasts to osteocytes Scientific Reports 2023-01-19 [PMID: 36658197] |
|
|
Reviews for DMP-1 Antibody (NBP1-89484) (0)
There are no reviews for DMP-1 Antibody (NBP1-89484).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for DMP-1 Antibody (NBP1-89484). (Showing 1 - 1 of 1 FAQs).
-
Does NBP1-89484 have cross-reactivity with mouse/rat or not?
- NBP1-89484 has only been tested and validated for use in human tissues at this point. The % homology between human and mouse/rat is only around 63% which is low and we do not expect it to cross react.
Secondary Antibodies
| |
Isotype Controls
|
Additional DMP-1 Products
Blogs on DMP-1