DMP-1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DMP-1 Antibody [NBP1-89484] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli & vesicles.
Immunohistochemistry-Paraffin: DMP-1 Antibody [NBP1-89484] - Staining of human breast shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DMP-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QYIYRLAGGFSRSTGKGGDDKDDDEDDSGDDTFGDDDSGPGPKDRQEGGNSRLGSDEDSDDTIQASEESAPQGQDSAQDTTSE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DMP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DMP-1 Protein (NBP1-89484PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DMP-1 Antibody

  • ARHP
  • ARHR
  • dentin matrix acidic phosphoprotein 1
  • dentin matrix acidic phosphoprotein
  • Dentin matrix protein 1
  • DMP1
  • DMP-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91612
Species: Mu
Applications: WB
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
2629-FG/CF
Species: Mu
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
8090-ZN
Species: Hu
AF6150
Species: Mu
Applications: WB
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-42378
Species: Hu
Applications: WB, IHC
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for DMP-1 Antibody (NBP1-89484) (0)

There are no publications for DMP-1 Antibody (NBP1-89484).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DMP-1 Antibody (NBP1-89484) (0)

There are no reviews for DMP-1 Antibody (NBP1-89484). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DMP-1 Antibody (NBP1-89484). (Showing 1 - 1 of 1 FAQ).

  1. Does NBP1-89484 have cross-reactivity with mouse/rat or not?
    • NBP1-89484 has only been tested and validated for use in human tissues at this point. The % homology between human and mouse/rat is only around 63% which is low and we do not expect it to cross react.

Secondary Antibodies

 

Isotype Controls

Additional DMP-1 Products

Bioinformatics Tool for DMP-1 Antibody (NBP1-89484)

Discover related pathways, diseases and genes to DMP-1 Antibody (NBP1-89484). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DMP-1 Antibody (NBP1-89484)

Discover more about diseases related to DMP-1 Antibody (NBP1-89484).
 

Pathways for DMP-1 Antibody (NBP1-89484)

View related products by pathway.

PTMs for DMP-1 Antibody (NBP1-89484)

Learn more about PTMs related to DMP-1 Antibody (NBP1-89484).

Blogs on DMP-1

There are no specific blogs for DMP-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DMP-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DMP1
Entrez