![Immunohistochemistry-Paraffin: DMGDH Antibody [NBP2-32666] - Staining of human colon.](http://images.novusbio.com/fullsize2/DMGDH-Antibody-Immunohistochemistry-Paraffin-NBP2-32666-img0006.jpg "Immunohistochemistry-Paraffin: DMGDH Antibody [NBP2-32666] - Staining of human colon.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IINVVNGPITYSPDILPMVGPHQGVRNYWVAIGFGYGIIHAGGVGKYLSDWILHGEPPFDLIELDPNRYGKWTTTQYTE |
| Predicted Species | Mouse (97%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DMGDH |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Western-Blot-NB100-74510-img0013.jpg)
-Immunocytochemistry-Immunofluorescence-NB100-74510-img0017.jpg)
-Immunocytochemistry-Immunofluorescence-NB100-74510-img0020.jpg)
-Flow-Cytometry-NBP2-01506-img0001.jpg)
-Flow-Cytometry-NBP2-01506-img0002.jpg)
-Western-Blot-NBP2-01506-img0003.jpg)
---Azide-and-BSA-Free-Western-Blot-NBP2-74045-img0001.jpg)
---Azide-and-BSA-Free-Flow-Cytometry-NBP2-74045-img0002.jpg)
---Azide-and-BSA-Free-Immunohistochemistry-NBP2-74045-img0003.jpg)
-ELISA-H00342184-M07-img0005.jpg)
-Immunocytochemistry-Immunofluorescence-H00342184-M07-img0001.jpg)
-Western-Blot-H00342184-M07-img0004.jpg)
![Flow Cytometry FOLR1 Antibody (548908) [Unconjugated]](https://images.novusbio.com/images2/FOLR1_MAB5646_Flow_Cytometry_10781.jpg)
![Western Blot FOLR1 Antibody (548908) [Unconjugated]](https://images.novusbio.com/images2/FOLR1_MAB5646_Western_Blot_6248.jpg)
![Immunocytochemistry FOLR1 Antibody (548908) [Unconjugated]](https://images.novusbio.com/images2/FOLR1_MAB5646_Immunocytochemistry_6624.jpg)
-Immunohistochemistry-NB600-1081-img0004.jpg)
-Immunohistochemistry-NB600-1081-img0003.jpg)
-Immunohistochemistry-Frozen-NB600-1081-img0005.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for DMGDH Antibody (NBP2-32666)Discover more about diseases related to DMGDH Antibody (NBP2-32666).
| Pathways for DMGDH Antibody (NBP2-32666)View related products by pathway.
|
PTMs for DMGDH Antibody (NBP2-32666)Learn more about PTMs related to DMGDH Antibody (NBP2-32666).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DMGDH |
![Immunohistochemistry-Paraffin: DMGDH Antibody [NBP2-32666] - Staining of human liver shows high expression.](http://images.novusbio.com/fullsize2/DMGDH-Antibody-Immunohistochemistry-Paraffin-NBP2-32666-img0002.jpg "Immunohistochemistry-Paraffin: DMGDH Antibody [NBP2-32666] - Staining of human liver shows high expression.")
![Immunohistochemistry-Paraffin: DMGDH Antibody [NBP2-32666] - Staining of human lymph node shows low expression as expected.](http://images.novusbio.com/fullsize2/DMGDH-Antibody-Immunohistochemistry-Paraffin-NBP2-32666-img0003.jpg "Immunohistochemistry-Paraffin: DMGDH Antibody [NBP2-32666] - Staining of human lymph node shows low expression as expected.")
![Immunohistochemistry-Paraffin: DMGDH Antibody [NBP2-32666] - Staining in human liver and lymph node tissues using anti-DMGDH antibody. Corresponding DMGDH RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/DMGDH-Antibody-Immunohistochemistry-Paraffin-NBP2-32666-img0004.jpg "Immunohistochemistry-Paraffin: DMGDH Antibody [NBP2-32666] - Staining in human liver and lymph node tissues using anti-DMGDH antibody. Corresponding DMGDH RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: DMGDH Antibody [NBP2-32666] - Staining of human colon, kidney, liver and lymph node using Anti-DMGDH antibody NBP2-32666 (A) shows similar protein distribution across tissues to independent antibody NBP1-86289 (B).](http://images.novusbio.com/fullsize2/DMGDH-Antibody-Immunohistochemistry-Paraffin-NBP2-32666-img0005.jpg "Immunohistochemistry-Paraffin: DMGDH Antibody [NBP2-32666] - Staining of human colon, kidney, liver and lymph node using Anti-DMGDH antibody NBP2-32666 (A) shows similar protein distribution across tissues to independent antibody NBP1-86289 (B).")
![Immunohistochemistry-Paraffin: DMGDH Antibody [NBP2-32666] - Staining of human kidney.](http://images.novusbio.com/fullsize2/DMGDH-Antibody-Immunohistochemistry-Paraffin-NBP2-32666-img0007.jpg "Immunohistochemistry-Paraffin: DMGDH Antibody [NBP2-32666] - Staining of human kidney.")
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/BRCA2_MAB2476_Western_Blot_6033.jpg)
![Immunohistochemistry BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/mab2476_human-brca2-mab-clone-234403-immunohistochemistry-10520211657.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")