DMGDH Antibody - BSA Free

Immunohistochemistry-Paraffin: DMGDH Antibody [NBP2-32666] - Staining of human colon.

Immunohistochemistry-Paraffin: DMGDH Antibody [NBP2-32666] - Staining of human liver shows high expression.

Immunohistochemistry-Paraffin: DMGDH Antibody [NBP2-32666] - Staining of human lymph node shows low expression as expected.

Immunohistochemistry-Paraffin: DMGDH Antibody [NBP2-32666] - Staining in human liver and lymph node tissues using anti-DMGDH antibody. Corresponding DMGDH RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: DMGDH Antibody [NBP2-32666] - Staining of human colon, kidney, liver and lymph node using Anti-DMGDH antibody NBP2-32666 (A) shows similar protein distribution across tissues to independent antibody NBP1-86289 (B).

Immunohistochemistry-Paraffin: DMGDH Antibody [NBP2-32666] - Staining of human kidney.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DMGDH Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DMGDH Antibody - BSA Free (NBP2-32666) is a polyclonal antibody validated for use in IHC. Anti-DMGDH Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IINVVNGPITYSPDILPMVGPHQGVRNYWVAIGFGYGIIHAGGVGKYLSDWILHGEPPFDLIELDPNRYGKWTTTQYTE
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DMGDH
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DMGDH Protein (NBP2-32666PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DMGDH Antibody - BSA Free

• dimethylglycine dehydrogenase
• dimethylglycine dehydrogenase, mitochondrial
• DMGDHD
• EC 1.5.99.2
• ME2GLYDH

Background

The DMGDH gene encodes an enzyme involved in the catabolism of choline, catalyzing the oxidative demethylation of dimethylglycine to form sarcosine. The enzyme is found as a monomer in the mitochondrial matrix, and uses flavin adenine dinucleotide and folate a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DMGDH Antibody (NBP2-32666)(1)

Publication using NBP2-32666

• Liu G, Hou G, Li L et al. Potential diagnostic and prognostic marker dimethylglycine dehydrogenase (DMGDH) suppresses hepatocellular carcinoma metastasis in vitro and in vivo. Oncotarget. 2016-05-31 [PMID: 27119355]

Bioinformatics

• Gene Symbol: DMGDH