DLX5 Antibody (2F9C6) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 150-250 of human DLX5 (P56178). AALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPAS |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
DLX5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for DLX5 Antibody (2F9C6)
Background
Dlx5 (distal-less homeobox 5) gene is a member of a homeobox gene family similiar to the Drosophila distal-less gene. The encoded Dlx5 protein is localized to the nucleus where it functions as a transcriptional regulator during neural development. In the developing CNS, Dlx5 is one of the earliest known markers before the formation of an overt neural plate. During late gastrulation Dlx5 (gene) expression becomes localized to the anterior neural ridge, which defines the rostral boundary of the neural plate, and also extends caudolaterally, marking the region of the presumptive neural crest. Subsequently, Dlx5 is expressed in tissues (olfactory epithelium, ventral cephalic epithelium) that are believed to derive from the anterior neural ridge.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: BA, BA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
Species: Hu, Mu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
Species: Hu
Applications: WB
Publications for DLX5 Antibody (NBP3-16605) (0)
There are no publications for DLX5 Antibody (NBP3-16605).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DLX5 Antibody (NBP3-16605) (0)
There are no reviews for DLX5 Antibody (NBP3-16605).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DLX5 Antibody (NBP3-16605) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DLX5 Products
Research Areas for DLX5 Antibody (NBP3-16605)
Find related products by research area.
|
Blogs on DLX5