DLST Antibody

Images

 
Western Blot: DLST Antibody [H00001743-B01P] - Analysis of DLST expression in human liver.
Immunocytochemistry/ Immunofluorescence: DLST Antibody [H00001743-B01P] - Analysis of purified antibody to DLST on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: DLST Antibody [H00001743-B01P] - Analysis of DLST expression in HepG2.
Western Blot: DLST Antibody [H00001743-B01P] - Analysis of DLST expression in transfected 293T cell line by DLST polyclonal antibody. Lane 1: DLST transfected lysate(49.83 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DLST Antibody Summary

Immunogen
DLST (NP_001924.2, 1 a.a. - 453 a.a.) full-length human protein. MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFFRTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
Specificity
DLST-dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
DLST
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DLST Antibody

  • 2-oxoglutarate dehydrogenase complex component E2
  • dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutaratecomplex)
  • Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenasecomplex
  • dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutaratedehydrogenase complex, mitochondrial
  • DLTS
  • E2K
  • EC 2.3.1
  • EC 2.3.1.61
  • OGDC-E2

Background

DLST - dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34065
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56992
Species: Hu
Applications: IHC-P
NBP1-88347
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF6014
Species: Hu, Mu, Rt
Applications: WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46214
Species: Hu
Applications: WB, IHC
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00001743-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for DLST Antibody (H00001743-B01P) (0)

There are no publications for DLST Antibody (H00001743-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DLST Antibody (H00001743-B01P) (0)

There are no reviews for DLST Antibody (H00001743-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DLST Antibody (H00001743-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DLST Products

Bioinformatics Tool for DLST Antibody (H00001743-B01P)

Discover related pathways, diseases and genes to DLST Antibody (H00001743-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DLST Antibody (H00001743-B01P)

Discover more about diseases related to DLST Antibody (H00001743-B01P).
 

Pathways for DLST Antibody (H00001743-B01P)

View related products by pathway.

PTMs for DLST Antibody (H00001743-B01P)

Learn more about PTMs related to DLST Antibody (H00001743-B01P).

Blogs on DLST

There are no specific blogs for DLST, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DLST Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DLST
Entrez
OMIM
Uniprot