DLG7/HURP Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DLG7/HURP Source: E.coli
Amino Acid Sequence: QTRLLMKERFKQFEGLVDDCEYKRGIKETTCTDLDGFWDMVSFQIEDVIHKFNNLIKLEESGWQVNNNMNHNMNKNVFRKKVVSGIASKPKQDDAGRI Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
DLGAP5 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24790It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for DLG7/HURP Recombinant Protein Antigen
Background
DLG7/HURP is a novel component of the Ran-importin spindle assembly pathway. DLG7/HURP binds microtubules and affects their organization both in vitro and in vivo. In egg extract, anti-DLG7/HURP antibodies disrupt the formation of both Ran-dependent and chromatin and centrosome-induced spindles. DLG7/HURP is also required for the proper formation and function of mitotic spindles in HeLa cells. DLG7/HURP is also over-expressed in some tumor types
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
Species: Hu, Ma, Mu, Po, Rt
Applications: Flow, ICC/IF, IP, KD, Simple Western, WB
Species: Ha, Hu, Mar, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, PLA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, Simple Western, WB
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Po
Applications: IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, S-ELISA, WB
Publications for DLG7/HURP Recombinant Protein Antigen (NBP3-24790PEP) (0)
There are no publications for DLG7/HURP Recombinant Protein Antigen (NBP3-24790PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DLG7/HURP Recombinant Protein Antigen (NBP3-24790PEP) (0)
There are no reviews for DLG7/HURP Recombinant Protein Antigen (NBP3-24790PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for DLG7/HURP Recombinant Protein Antigen (NBP3-24790PEP) (0)
Additional DLG7/HURP Products
Research Areas for DLG7/HURP Recombinant Protein Antigen (NBP3-24790PEP)
Find related products by research area.
|
Blogs on DLG7/HURP