DLEU1 Antibody

Immunocytochemistry/Immunofluorescence: DLEU1 Antibody [NBP2-55430] - Staining of human cell line A-431 shows localization to plasma membrane & cytosol.

Product Discontinued

DLEU1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MRPCIWIHVHLKPPCRLVELLPFSSALQGLSHLSLGTTLPVILPERNEEQNLQELSHNADKYQMGDCCKEEIDDSI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DLEU1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DLEU1 Antibody

• BCMS
• deleted in lymphocytic leukemia 1 (non-protein coding)
• Deleted in lymphocytic leukemia 1
• deleted in lymphocytic leukemia, 1
• DLB1
• DLEU2
• HBV XAg-transactivated protein 6
• HBV X-transactivated gene 6 protein
• LEU1LEU2
• NCRNA00021
• XTP6MGC22430

Background

DLEU1 may act as a tumor suppressor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DLEU1