Novus Biologicals products are now on bio-techne.com

Dkk-3 Antibody

Images

 
Western Blot: Dkk-3 Antibody [NBP1-80843] - Analysis in control (vector only transfected HEK293T lysate) and DKK3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: Dkk-3 Antibody [NBP1-80843] - Staining of human cell line A-431 shows localization to vesicles.
Immunohistochemistry-Paraffin: Dkk-3 Antibody [NBP1-80843] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Dkk-3 Antibody [NBP1-80843] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Dkk-3 Antibody [NBP1-80843] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Dkk-3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CGDQLCVWGHCTKMATRGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDRCPCASGLLCQPHSHSLVYVCKPTFVGSRDQDGEILLPREVPDEYLAASW
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DKK3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Dkk-3 Protein (NBP1-80843PEP)
Publications
Read Publications using
NBP1-80843 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Dkk-3 Antibody

  • dickkopf (Xenopus laevis) homolog 3
  • dickkopf 3
  • dickkopf homolog 3 (Xenopus laevis)
  • Dickkopf-3
  • dickkopf-related protein 3
  • Dkk3
  • Dkk-3
  • hDkk-3
  • regulated in glioma
  • REIC
  • REICdkk-3
  • RIG
  • RIG-like 5-6
  • RIG-like 7-1

Background

DKK3 is a secreted protein that is a member of the dickkopf family. It contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. The expression of this gene is decreased in a variety of cancer cell lines and it may function as a tumor suppressor gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

5439-DK
Species: Hu
Applications: BA
5396-SF
Species: Hu
Applications: BA
1341-WF
Species: Hu
Applications: BA
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
AF2435
Species: Mu
Applications: IHC, WB
1169-FR
Species: Mu
Applications: Bind
AF4859
Species: Hu
Applications: WB
6266-SF
Species: Hu
Applications: BA
1827-SF/CF
Species: Hu
Applications: BA
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
1269-DK/CF
Species: Hu
Applications: BA
NBP2-33717
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-1244
Species: Hu, Mu, Pm
Applications: Flow, IHC, IHC-P, PEP-ELISA
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
AF820
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-86856
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83224
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80843
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for Dkk-3 Antibody (NBP1-80843)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IF/IHC.


Filter By Application
IF/IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Dkk-3 Antibody (NBP1-80843) (0)

There are no reviews for Dkk-3 Antibody (NBP1-80843). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Dkk-3 Antibody (NBP1-80843) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dkk-3 Products

Research Areas for Dkk-3 Antibody (NBP1-80843)

Find related products by research area.

Blogs on Dkk-3

There are no specific blogs for Dkk-3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dkk-3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DKK3
Entrez
Uniprot