Dkk-3 Antibody - BSA Free

Western Blot: Dkk-3 Antibody [NBP1-80843] - Analysis in control (vector only transfected HEK293T lysate) and DKK3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: Dkk-3 Antibody [NBP1-80843] - Staining of human cell line A-431 shows localization to vesicles.

Immunohistochemistry-Paraffin: Dkk-3 Antibody [NBP1-80843] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: Dkk-3 Antibody [NBP1-80843] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: Dkk-3 Antibody [NBP1-80843] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Dkk-3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Dkk-3 Antibody - BSA Free (NBP1-80843) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Dkk-3 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CGDQLCVWGHCTKMATRGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDRCPCASGLLCQPHSHSLVYVCKPTFVGSRDQDGEILLPREVPDEYLAASW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DKK3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Dkk-3 Protein (NBP1-80843PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Dkk-3 Antibody - BSA Free

• dickkopf (Xenopus laevis) homolog 3
• dickkopf 3
• dickkopf homolog 3 (Xenopus laevis)
• Dickkopf-3
• dickkopf-related protein 3
• Dkk3
• Dkk-3
• hDkk-3
• regulated in glioma
• REIC
• REICdkk-3
• RIG
• RIG-like 5-6
• RIG-like 7-1

Background

DKK3 is a secreted protein that is a member of the dickkopf family. It contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. The expression of this gene is decreased in a variety of cancer cell lines and it may function as a tumor suppressor gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Dkk-3 Antibody (NBP1-80843)(2)

Publications using NBP1-80843

• Ueno K, Saika S, Okada Y et al. Impaired healing of cutaneous wound in a Trpv1 deficient mouse Experimental animals 2022-11-25 [PMID: 36436910] (IF/IHC, Mouse)
• Zhen X, Park SJ, Choe SH et al. Generation of induced pluripotent stem cells (cmESF-iPS-C5) derived from cynomolgus monkey ear skin fibroblasts (cmESF) Stem cell research 2022-11-15 [PMID: 36403550]

Bioinformatics

• Gene Symbol: DKK3
• Entrez:
  • 27122(Human)
• Uniprot:
  • Q9UBP4()
  • Q9UBP4()
  • Q9UBP4()
  • Q9UBP4()