Dkk-3 Antibody

Images

 
Western Blot: Dkk-3 Antibody [NBP1-80843] - Analysis in control (vector only transfected HEK293T lysate) and DKK3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: Dkk-3 Antibody [NBP1-80843] - Staining of human cell line A-431 shows localization to vesicles.
Immunohistochemistry-Paraffin: Dkk-3 Antibody [NBP1-80843] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Dkk-3 Antibody [NBP1-80843] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Dkk-3 Antibody [NBP1-80843] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Dkk-3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CGDQLCVWGHCTKMATRGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDRCPCASGLLCQPHSHSLVYVCKPTFVGSRDQDGEILLPREVPDEYLAASW
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DKK3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Dkk-3 Protein (NBP1-80843PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Dkk-3 Antibody

  • dickkopf (Xenopus laevis) homolog 3
  • dickkopf 3
  • dickkopf homolog 3 (Xenopus laevis)
  • Dickkopf-3
  • dickkopf-related protein 3
  • Dkk3
  • Dkk-3
  • hDkk-3
  • regulated in glioma
  • REIC
  • REICdkk-3
  • RIG
  • RIG-like 5-6
  • RIG-like 7-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

5439-DK/CF
Species: Hu
Applications: BA
5396-SF
Species: Hu
Applications: BA
1341-WF/CF
Species: Hu
Applications: BA
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
AF2435
Species: Mu
Applications: IHC, WB
1169-FR/CF
Species: Mu
Applications: Bind
AF4859
Species: Hu
Applications: WB
6266-SF
Species: Hu
Applications: BA
1827-SF/CF
Species: Hu
Applications: BA
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
1269-DK/CF
Species: Hu
Applications: BA
NBP2-33717
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-1244
Species: Hu, Mu, Pm
Applications: Flow, IHC, IHC-P, PEP-ELISA
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-86856
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83224
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Dkk-3 Antibody (NBP1-80843) (0)

There are no publications for Dkk-3 Antibody (NBP1-80843).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dkk-3 Antibody (NBP1-80843) (0)

There are no reviews for Dkk-3 Antibody (NBP1-80843). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Dkk-3 Antibody (NBP1-80843) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dkk-3 Products

Bioinformatics Tool for Dkk-3 Antibody (NBP1-80843)

Discover related pathways, diseases and genes to Dkk-3 Antibody (NBP1-80843). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dkk-3 Antibody (NBP1-80843)

Discover more about diseases related to Dkk-3 Antibody (NBP1-80843).
 

Pathways for Dkk-3 Antibody (NBP1-80843)

View related products by pathway.

PTMs for Dkk-3 Antibody (NBP1-80843)

Learn more about PTMs related to Dkk-3 Antibody (NBP1-80843).
 

Research Areas for Dkk-3 Antibody (NBP1-80843)

Find related products by research area.

Blogs on Dkk-3

There are no specific blogs for Dkk-3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dkk-3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DKK3
Entrez
Uniprot