DISP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DISP1 Antibody [NBP2-13925] - Immunofluorescent staining of human cell line HEK 293 shows localization to nuclear bodies.
Immunohistochemistry-Paraffin: DISP1 Antibody [NBP2-13925] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DISP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GKTNVHSLQRSIEEHLPKMAEPSSFVCRSTGSLLKTCCDPENKQRELCKN RDVSNLESSGGTENKAGGKVELSLSQTDASVNSE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DISP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DISP1 Protein (NBP2-13925PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DISP1 Antibody

  • DISP1
  • DISPA
  • DISPAFLJ43740
  • dispatched A
  • dispatched homolog 1 (Drosophila)
  • Dispatched
  • DKFZp434I0428
  • MGC104180
  • MGC13130
  • MGC16796
  • protein dispatched homolog 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7555
Species: Hu
Applications: WB, Simple Western
AF2400
Species: Hu
Applications: WB, ChIP, ICC
NBP1-57016
Species: Hu
Applications: WB
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NBP2-24607
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB
MAB8434
Species: Hu
Applications: WB
H00006496-M04
Species: Hu
Applications: WB, ELISA
H00064399-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14089
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-47945
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89719
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DISP1 Antibody (NBP2-13925) (0)

There are no publications for DISP1 Antibody (NBP2-13925).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DISP1 Antibody (NBP2-13925) (0)

There are no reviews for DISP1 Antibody (NBP2-13925). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DISP1 Antibody (NBP2-13925) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DISP1 Products

DISP1 NBP2-13925

Bioinformatics Tool for DISP1 Antibody (NBP2-13925)

Discover related pathways, diseases and genes to DISP1 Antibody (NBP2-13925). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DISP1 Antibody (NBP2-13925)

Discover more about diseases related to DISP1 Antibody (NBP2-13925).
 

Pathways for DISP1 Antibody (NBP2-13925)

View related products by pathway.

Research Areas for DISP1 Antibody (NBP2-13925)

Find related products by research area.

Blogs on DISP1

There are no specific blogs for DISP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DISP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DISP1
Entrez