Dishevelled-2 Antibody

Images

 
Western Blot: Dishevelled-2 Antibody [NBP1-87550] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunohistochemistry-Paraffin: Dishevelled-2 Antibody [NBP1-87550] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Dishevelled-2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FNGRVVSWLVSSDNPQPEMAPPVHEPRAELAPPAPPLPPLPPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DVL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Dishevelled-2 Protein (NBP1-87550PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Dishevelled-2 Antibody

  • dishevelled 2 (homologous to Drosophila dsh)
  • dishevelled, dsh homolog 2 (Drosophila)
  • Dishevelled2
  • Dishevelled-2
  • DSH homolog 2
  • DVL2
  • segment polarity protein dishevelled homolog DVL-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24648
Species: Hu, Mu, Rt, Pm
Applications: WB
NBP2-24674
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, IHC-P
645-WN/CF
Species: Hu, Mu
AF4815
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF1927
Species: Hu
Applications: WB, IP, ICC
AF7164
Species: Hu
Applications: WB
AF6278
Species: Hu, Mu
Applications: WB
AF3287
Species: Hu, Mu, Rt
Applications: WB
NBP2-24768
Species: Hu, Mu, Rt, Ch, Pm, Xp, Ze
Applications: WB, IHC-P
AF1505
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
NBP2-44192
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBL1-07321
Species: Hu
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-46367
Species: Hu
Applications: WB, IHC

Publications for Dishevelled-2 Antibody (NBP1-87550) (0)

There are no publications for Dishevelled-2 Antibody (NBP1-87550).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dishevelled-2 Antibody (NBP1-87550) (0)

There are no reviews for Dishevelled-2 Antibody (NBP1-87550). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Dishevelled-2 Antibody (NBP1-87550) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dishevelled-2 Products

Bioinformatics Tool for Dishevelled-2 Antibody (NBP1-87550)

Discover related pathways, diseases and genes to Dishevelled-2 Antibody (NBP1-87550). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dishevelled-2 Antibody (NBP1-87550)

Discover more about diseases related to Dishevelled-2 Antibody (NBP1-87550).
 

Pathways for Dishevelled-2 Antibody (NBP1-87550)

View related products by pathway.

PTMs for Dishevelled-2 Antibody (NBP1-87550)

Learn more about PTMs related to Dishevelled-2 Antibody (NBP1-87550).
 

Research Areas for Dishevelled-2 Antibody (NBP1-87550)

Find related products by research area.

Blogs on Dishevelled-2

There are no specific blogs for Dishevelled-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dishevelled-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DVL2
Entrez