DIEXF Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DIEXF Antibody [NBP1-88480] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: DIEXF Antibody [NBP1-88480] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DIEXF Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLPLDSHGVDFSRVRMWSLNNWSKYYRQTLLFGALQDAQINSVFNKYCVNMQGQVAVRNVPMTGSISHVLVQLPHVFQRMEAENLASVIDARFNFFVNKILPQYRDAVM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DIEXF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DIEXF Protein (NBP1-88480PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DIEXF Antibody

  • C1orf107
  • chromosome 1 open reading frame 107
  • DEFFLJ41680
  • digestive organ expansion factor homolog (zebrafish)
  • digestive organ expansion factor homolog
  • digestive-organ expansion factor homolog
  • DJ434O14.5
  • DKFZp686E19106
  • FLJ12704
  • MGC29875

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA

Publications for DIEXF Antibody (NBP1-88480) (0)

There are no publications for DIEXF Antibody (NBP1-88480).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DIEXF Antibody (NBP1-88480) (0)

There are no reviews for DIEXF Antibody (NBP1-88480). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DIEXF Antibody (NBP1-88480). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for an antibody to DIEXF (like NBP1-88480) that will cross-react with zebrafish. The immunogen described in product sheet is large, so I was wondering if the actual antigen was smaller and if it will cross-react?
    • NBP1-88480 is our only DIEXF antibody. This has been designed for the human protein and has not yet been tested in zebrafish. The immunogen sequence given on the datasheet for NBP1-88480 is the actual immunogen. We have not performed any epitope mapping experiments using this antibody. I have used this immunogen sequence to run a UniProt BLAST against the equivalent zebrafish sequence, and the % homology is 62%, which is relatively low, indicating that this antibody may not be suitable for your requirements, although it is difficult for us to predict the results. If you wish to go ahead and test this antibody with zebrafish, you would be eligible for our Innovator's Reward program.

Secondary Antibodies

 

Isotype Controls

Additional DIEXF Products

Bioinformatics Tool for DIEXF Antibody (NBP1-88480)

Discover related pathways, diseases and genes to DIEXF Antibody (NBP1-88480). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on DIEXF

There are no specific blogs for DIEXF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DIEXF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DIEXF