DIEXF Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: LLPLDSHGVDFSRVRMWSLNNWSKYYRQTLLFGALQDAQINSVFNKYCVNMQGQVAVRNVPMTGSISHVLVQLPHVFQRMEAENLASVIDARFNFFVNKILPQYRDAVM |
| Predicted Species |
Mouse (93%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
UTP25 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for DIEXF Antibody - BSA Free
Background
Regulates the p53 pathway to control the expansion growth of digestive organs
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu, Rt
Applications: IHC
Publications for DIEXF Antibody (NBP1-88480) (0)
There are no publications for DIEXF Antibody (NBP1-88480).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DIEXF Antibody (NBP1-88480) (0)
There are no reviews for DIEXF Antibody (NBP1-88480).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for DIEXF Antibody (NBP1-88480). (Showing 1 - 1 of 1 FAQ).
-
I am looking for an antibody to DIEXF (like NBP1-88480) that will cross-react with zebrafish. The immunogen described in product sheet is large, so I was wondering if the actual antigen was smaller and if it will cross-react?
- NBP1-88480 is our only DIEXF antibody. This has been designed for the human protein and has not yet been tested in zebrafish. The immunogen sequence given on the datasheet for NBP1-88480 is the actual immunogen. We have not performed any epitope mapping experiments using this antibody. I have used this immunogen sequence to run a UniProt BLAST against the equivalent zebrafish sequence, and the % homology is 62%, which is relatively low, indicating that this antibody may not be suitable for your requirements, although it is difficult for us to predict the results. If you wish to go ahead and test this antibody with zebrafish, you would be eligible for our Innovator's Reward program.
Secondary Antibodies
| |
Isotype Controls
|
Additional DIEXF Products
Blogs on DIEXF