DHX38 Antibody


Western Blot: DHX38 Antibody [NBP2-58971] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: DHX38 Antibody [NBP2-58971] - Staining of human cell line MCF7 shows localization to nucleus.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF

Order Details

DHX38 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IPVKDATSDLAIIARKGSQTVRKHREQKERKKAQHKHWELAGTKLGDIMGVKKEEEPDKAVTEDGKVDYRTEQKFADHMKRKSEASSEFAKKKSIL
Specificity of human DHX38 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DHX38 Recombinant Protein Antigen (NBP2-58971PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for DHX38 Antibody

  • ATP-dependent RNA helicase DHX38
  • DDX38pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 38
  • DEAH (Asp-Glu-Ala-His) box polypeptide 38
  • DEAH box protein 38
  • EC 3.6.1
  • EC
  • KIAA0224pre-mRNA splicing factor ATP-dependent RNA helicase PRP16
  • PRP16 homolog of S.cerevisiae
  • PRP16hPrp16
  • PRPF16


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA, KD
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: All-NA
Applications: WB, IHC, IHC-P

Publications for DHX38 Antibody (NBP2-58971) (0)

There are no publications for DHX38 Antibody (NBP2-58971).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DHX38 Antibody (NBP2-58971) (0)

There are no reviews for DHX38 Antibody (NBP2-58971). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DHX38 Antibody (NBP2-58971) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional DHX38 Products

Array NBP2-58971

Bioinformatics Tool for DHX38 Antibody (NBP2-58971)

Discover related pathways, diseases and genes to DHX38 Antibody (NBP2-58971). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DHX38 Antibody (NBP2-58971)

Discover more about diseases related to DHX38 Antibody (NBP2-58971).

Pathways for DHX38 Antibody (NBP2-58971)

View related products by pathway.

PTMs for DHX38 Antibody (NBP2-58971)

Learn more about PTMs related to DHX38 Antibody (NBP2-58971).

Blogs on DHX38

There are no specific blogs for DHX38, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DHX38 Antibody and receive a gift card or discount.


Gene Symbol DHX38