DHX36 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

DHX36 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DHX36
  
  

  Source: E.coli

  Amino Acid Sequence: VVEYLLEDVIEKIRYVPEQKEHRSQFKRGFMQGHVNRQEKEEKEAIYKERWPDYVRELRRRYSASTVDVIEMMEDDKVDLNLIVALIR

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: DHX36
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24787It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DHX36 Recombinant Protein Antigen

• DDX36
• DEAH (Asp-Glu-Ala-His) box polypeptide 36
• DEAH box protein 36
• EC 3.6.1
• EC 3.6.4.13
• G4 resolvase-1
• KIAA1488G4R1
• MLEL1RHAUDEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 36
• MLE-like protein 1
• probable ATP-dependent RNA helicase DHX36
• RNA helicase associated with AU-rich element ARE

Background

DHX36, also known as Probable ATP-dependent RNA helicase DHX36, consists of three isoforms of sizes 114.7 kDa, 113.2 kDa, and 111.5 kDa and is involved in breaking down mRNA with the ARE element in their 3'-UTR strand. Current research links this protein to sex development and spermatogenesis. The protein interacts with RPS9, AGO1, UBC, AGO2, and PHB in the RNA degradation pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DHX36