DHRS7 Antibody - BSA Free

Western Blot: DHRS7 Antibody [NBP1-80842] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunocytochemistry/Immunofluorescence: DHRS7 Antibody [NBP1-80842] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.

Immunohistochemistry-Paraffin: DHRS7 Antibody [NBP1-80842] - Staining of human gall bladder shows cytoplasmic and membranous positivity in glandular cells.

Western Blot: DHRS7 Antibody [NBP1-80842] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-162

• Reactivity: Hu, Rt, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DHRS7 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DLTLLWAEWQGRRPEWELTDMVVWVTGASSGIGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMI
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DHRS7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC, ICC/IF reported in scientific literature (PMID: 26311046). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DHRS7 Recombinant Protein Antigen (NBP1-80842PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26311046).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DHRS7 Antibody - BSA Free

• dehydrogenase/reductase (SDR family) member 7,2310016E22Rik
• dehydrogenase/reductase SDR family member 7
• DHRS7A
• EC 1.1
• retDSR4
• Retinal short-chain dehydrogenase/reductase 4
• retSDR4
• SDR34C1
• short chain dehydrogenase/reductase family 34C, member 1

Background

Short-chain dehydrogenases/reductases (SDRs), such as DHRS7, catalyze the oxidation/reduction of a wide range of substrates, including retinoids and steroids (Haeseleer and Palczewski, 2000 (PubMed 10800688)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DHRS7 Antibody (NBP1-80842)(3)

Publications using NBP1-80842

• Liu Z, Lin Z, Cao F et al. Upregulation of mir-1199-5p is associated with reduced type 2 5-alpha reductase expression in benign prostatic hyperplasia BMC urology 2022-11-07 [PMID: 36344974] (IHC-P, Human)
  
  Details:
  Dilution used in IHC 1:1500
• Chen Y, Huang A, Tan G, Liu H Antagonism of m3 Alleviates Type 2 Inflammation in Allergic Rhinitis Mice American journal of rhinology & allergy 2022-11-07 [PMID: 36343939]
• Seibert JK, Quagliata L, Quintavalle C et al. A role for the dehydrogenase DHRS7 (SDR34C1) in prostate cancer. Cancer Med 2015-11-01 [PMID: 26311046] (IF/IHC, ICC/IF, Human)

Bioinformatics

• Gene Symbol: DHRS7
• Entrez:
  • 51635(Human)