DHODH Antibody

Images

 
Western Blot: DHODH Antibody [NBP1-86097] - Analysis in human cell line MCF-7.
Immunocytochemistry/ Immunofluorescence: DHODH Antibody [NBP1-86097] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: DHODH Antibody [NBP1-86097] - Staining of human kidney shows strong cytoplasmic positivity in granular pattern in tubule cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DHODH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DHODH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DHODH Protein (NBP1-86097PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DHODH Antibody

  • DHOdehase
  • dihydroorotate dehydrogenase
  • dihydroorotate dehydrogenase, mitochondrial
  • Dihydroorotate oxidase
  • EC 1.3.3.1
  • EC 1.3.5.2
  • human complement of yeast URA1
  • POADS
  • URA1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85896
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-705
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-70352
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IF
NB110-74753
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-55460
Species: Hu
Applications: WB, ICC/IF
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87408
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-935
Species: Bv
Applications: WB, ELISA, IP
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
AF3848
Species: Hu
Applications: WB, IHC, IP
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86097
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DHODH Antibody (NBP1-86097) (0)

There are no publications for DHODH Antibody (NBP1-86097).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DHODH Antibody (NBP1-86097) (0)

There are no reviews for DHODH Antibody (NBP1-86097). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DHODH Antibody (NBP1-86097) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DHODH Products

Bioinformatics Tool for DHODH Antibody (NBP1-86097)

Discover related pathways, diseases and genes to DHODH Antibody (NBP1-86097). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DHODH Antibody (NBP1-86097)

Discover more about diseases related to DHODH Antibody (NBP1-86097).
 

Pathways for DHODH Antibody (NBP1-86097)

View related products by pathway.

PTMs for DHODH Antibody (NBP1-86097)

Learn more about PTMs related to DHODH Antibody (NBP1-86097).

Blogs on DHODH

There are no specific blogs for DHODH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DHODH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DHODH