DGKH Antibody - BSA Free

Western Blot: DGKH Antibody [NBP2-87267] - WB Suggested Anti-DGKH Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Human heart

Immunohistochemistry: DGKH Antibody [NBP2-87267] - Sample Type: Adult mouse cortex. Primary Antibody Dilution: 1:500. Secondary Antibody: Anti-rabbit-Cy3. Secondary Antibody Dilution: 1:1000. Color/Signal Descriptions: Red: DGKH Cyan: Nissl (Neurons). Gene Name: DGKH. Submitted by: Joshua R. Sanes, Molecu

Western Blot: DGKH Antibody [NBP2-87267] - Host: Rabbit. Target: DGKH. Positive control (+): Human Brain (BR). Negative control (-): Human Fetal Heart (HE). Antibody concentration: 1ug/ml

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

DGKH Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DGKH Antibody - BSA Free (NBP2-87267) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DGKH. Peptide sequence: DLDSVDGYSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMW The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DGKH
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for DGKH Antibody - BSA Free

• DAG kinase eta
• DGKeta
• DGK-eta
• diacylglycerol kinase eta
• diacylglycerol kinase, eta
• Diglyceride kinase eta
• DKFZp761I1510
• EC 2.7.1.107

Background

DGKH, also known as Diacylglycerol kinase eta, consists of four isoforms of sizes 134.9 kDa, 128 kDa, 122.4 kDa, and 120.6 kDa and is involved in activating the signaling pathway Ras/B-Raf/C-Raf/MEK/ERK in order to promote cell growth. Current research is exploring the effect of the protein on diseases and disorders such as measles, neuronitis, bipolar disorder, and schizophrenia. The protein interacts with AGPAT2, AGPAT4, CHPT1, ARRB1, and DGKD proteins while in hemostasis, signal transduction, and metabolic pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DGKH