DGK-gamma Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DGK-gamma Antibody [NBP1-85316] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & vesicles.

• Reactivity: Hu, Mu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DGK-gamma Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DGK-gamma Antibody - BSA Free (NBP1-85316) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MGEERWVSLTPEEFDQLQKYSEYSSKKIKDALTEFNEGGSLKQYDPHEPISYDVFKLFMRAYLEVDLPQPLSTHLFLA
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DGKG
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DGK-gamma Protein (NBP1-85316PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DGK-gamma Antibody - BSA Free

• DAG kinase gamma
• DAGK3
• DAGK3MGC104993
• DGKG
• DGKgamma
• DGK-gamma
• diacylglycerol kinase gamma
• diacylglycerol kinase, gamma (90kD)
• diacylglycerol kinase, gamma 90kDa
• diacylglyerol kinase gamma
• Diglyceride kinase gamma
• EC 2.7.1.107
• MGC133330

Background

DGKG encodes an enzyme that is a member of the type I subfamily of diacylglycerol kinases, which are involved in lipid metabolism. These enzymes generate phosphatidic acid by catalyzing the phosphorylation of diacylglycerol, a fundamental lipid second messenger that activates numerous proteins, including protein kinase C isoforms, Ras guanyl nucleotide-releasing proteins and some transient receptor potential channels. Diacylglycerol kinase gamma has been implicated in cell cycle regulation and in the negative regulation of macrophage differentiation in leukemia cells. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DGKG