DGK-delta Antibody

Images

 
Immunohistochemistry-Paraffin: DGKD Antibody [NBP2-13917] - Staining of human breast shows strong cytoplasmic positivity in glandular and myoepithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DGK-delta Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TELLLSGKMALQLDPPQKEQLGSALAEMDRQLRRLADTPWLCQSAEPGDE ESVMLDLAKRSRSGKFRLVTKFKKEKNNKNKEAHS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DGKD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DGK-delta Protein (NBP2-13917PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DGK-delta Antibody

  • 130 kDa diacylglycerol kinase
  • DAG kinase delta
  • DGKD
  • dgkd-2
  • DGKdelta
  • DGK-delta
  • diacylglycerol kinase delta
  • diacylglycerol kinase, delta (130kD)
  • diacylglycerol kinase, delta 130kDa
  • Diglyceride kinase delta
  • FLJ26930
  • KIAA0145EC 2.7.1.107

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5125
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB6727
Species: Hu
Applications: WB
NBP1-84256
Species: Hu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00612
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
AF6008
Species: Hu, Mu, Rt
Applications: WB
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-07799
Species: Hu
H00005554-R02
Species: Hu
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-13917
Species: Hu
Applications: IHC, IHC-P

Publications for DGK-delta Antibody (NBP2-13917) (0)

There are no publications for DGK-delta Antibody (NBP2-13917).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DGK-delta Antibody (NBP2-13917) (0)

There are no reviews for DGK-delta Antibody (NBP2-13917). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DGK-delta Antibody (NBP2-13917) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DGK-delta Products

Bioinformatics Tool for DGK-delta Antibody (NBP2-13917)

Discover related pathways, diseases and genes to DGK-delta Antibody (NBP2-13917). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DGK-delta Antibody (NBP2-13917)

Discover more about diseases related to DGK-delta Antibody (NBP2-13917).
 

Pathways for DGK-delta Antibody (NBP2-13917)

View related products by pathway.

PTMs for DGK-delta Antibody (NBP2-13917)

Learn more about PTMs related to DGK-delta Antibody (NBP2-13917).
 

Research Areas for DGK-delta Antibody (NBP2-13917)

Find related products by research area.

Blogs on DGK-delta

There are no specific blogs for DGK-delta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DGK-delta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DGKD
Entrez