DGK-alpha Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DGK-alpha Antibody [NBP2-55682] - Staining of human cell line RT4 shows localization to vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DGK-alpha Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSL
Specificity
Specificity of human DGK-alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DGKA
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for DGK-alpha Antibody

  • DAG kinase alpha
  • DAGK
  • DAGK1
  • DAGK1diacylglycerol kinase, alpha (80kD)
  • DGKA
  • DGKalpha
  • DGK-alpha
  • DGK-alphaEC 2.7.1.107
  • diacylglycerol kinase alpha
  • diacylglycerol kinase, alpha 80kDa
  • Diglyceride kinase alpha
  • MGC12821,80 kDa diacylglycerol kinase
  • MGC42356

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6727
Species: Hu
Applications: WB
AF7069
Species: Hu, Mu
Applications: WB, IHC
NBP2-14868
Species: Hu, Mu, Eq
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
H00005555-P01
Species: Hu
NBP2-23368
Species: Hu
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-98413
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P

Publications for DGK-alpha Antibody (NBP2-55682) (0)

There are no publications for DGK-alpha Antibody (NBP2-55682).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DGK-alpha Antibody (NBP2-55682) (0)

There are no reviews for DGK-alpha Antibody (NBP2-55682). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DGK-alpha Antibody (NBP2-55682) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DGK-alpha Products

Bioinformatics Tool for DGK-alpha Antibody (NBP2-55682)

Discover related pathways, diseases and genes to DGK-alpha Antibody (NBP2-55682). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DGK-alpha Antibody (NBP2-55682)

Discover more about diseases related to DGK-alpha Antibody (NBP2-55682).
 

Pathways for DGK-alpha Antibody (NBP2-55682)

View related products by pathway.

PTMs for DGK-alpha Antibody (NBP2-55682)

Learn more about PTMs related to DGK-alpha Antibody (NBP2-55682).
 

Research Areas for DGK-alpha Antibody (NBP2-55682)

Find related products by research area.

Blogs on DGK-alpha

There are no specific blogs for DGK-alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DGK-alpha Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DGKA