DGCR2 Antibody


Immunocytochemistry/ Immunofluorescence: DGCR2 Antibody [NBP2-56538] - Staining of human cell line SiHa shows localization to nucleoplasm & nuclear bodies.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

DGCR2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('IHPDSVFYDPADDDAFEPVEVSLPAPGDGGSEGALLRRLEQPLPTAGASLADLEDSADSSSALLVPPDPAQSGSTPAAEALPGGGRHSRSSLNTV',)
Specificity of human DGCR2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DGCR2 Recombinant Protein Antigen (NBP2-56538PEP)

Reactivity Notes

Mouse 83%, Rat 82%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for DGCR2 Antibody

  • DGCR2
  • DGS-C
  • DiGeorge syndrome critical region gene 2
  • IDDDKFZp686I1730
  • integral membrane protein deleted in DiGeorge syndrome
  • integral membrane protein DGCR2/IDD
  • KIAA0163
  • KIAA0163DiGeorge syndrome critical region protein 2
  • LAN
  • SEZ-12


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF

Publications for DGCR2 Antibody (NBP2-56538) (0)

There are no publications for DGCR2 Antibody (NBP2-56538).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DGCR2 Antibody (NBP2-56538) (0)

There are no reviews for DGCR2 Antibody (NBP2-56538). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DGCR2 Antibody (NBP2-56538) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional DGCR2 Products

Bioinformatics Tool for DGCR2 Antibody (NBP2-56538)

Discover related pathways, diseases and genes to DGCR2 Antibody (NBP2-56538). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DGCR2 Antibody (NBP2-56538)

Discover more about diseases related to DGCR2 Antibody (NBP2-56538).

Pathways for DGCR2 Antibody (NBP2-56538)

View related products by pathway.

PTMs for DGCR2 Antibody (NBP2-56538)

Learn more about PTMs related to DGCR2 Antibody (NBP2-56538).

Blogs on DGCR2

There are no specific blogs for DGCR2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DGCR2 Antibody and receive a gift card or discount.


Gene Symbol DGCR2