DET1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DET1 Antibody [NBP2-13914] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & microtubules.
Immunohistochemistry-Paraffin: DET1 Antibody [NBP2-13914] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DET1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: THWHQVRVFHQNVFPNFTVVNVEKPPCFLRKFSPDGRYFIAFSSDQTSLE IYEYQGCQAAEDLLQGYEGEILSNGNDQRSVNIRGRLFERFFVLLHITNV AANGEHLNRECS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DET1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DET1 Protein (NBP2-13914PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DET1 Antibody

  • de-etiolated 1
  • de-etiolated homolog 1 (Arabidopsis)
  • De-etiolated-1 homolog
  • DET1 homolog
  • FLJ10103
  • MGC126156
  • MGC126157

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00114769-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00064326-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-33061
Species: Hu, Mu, Rt
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NBP1-84407
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP2-38854
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
E2-616
Species: Hu
AF3764
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-13914
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for DET1 Antibody (NBP2-13914) (0)

There are no publications for DET1 Antibody (NBP2-13914).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DET1 Antibody (NBP2-13914) (0)

There are no reviews for DET1 Antibody (NBP2-13914). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DET1 Antibody (NBP2-13914) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DET1 Products

Bioinformatics Tool for DET1 Antibody (NBP2-13914)

Discover related pathways, diseases and genes to DET1 Antibody (NBP2-13914). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DET1 Antibody (NBP2-13914)

Discover more about diseases related to DET1 Antibody (NBP2-13914).
 

Pathways for DET1 Antibody (NBP2-13914)

View related products by pathway.

PTMs for DET1 Antibody (NBP2-13914)

Learn more about PTMs related to DET1 Antibody (NBP2-13914).

Blogs on DET1

There are no specific blogs for DET1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DET1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DET1