Desmoplakin Antibody

Images

 
Immunohistochemistry-Paraffin: Desmoplakin Antibody [NBP2-49158] - Staining of human lymph node shows very weak positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: Desmoplakin Antibody [NBP2-49158] - Staining of human skeletal muscle shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Desmoplakin Antibody [NBP2-49158] - Staining in human skin and skeletal muscle tissues using anti-DSP antibody. Corresponding DSP RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: Desmoplakin Antibody [NBP2-49158] - Analysis in human skin and lymph node tissues using NBP2-49158 antibody. Corresponding DSP RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Desmoplakin Antibody [NBP2-49158] - Staining of human endometrium shows very weak positivity in glandular cells.
Immunohistochemistry-Paraffin: Desmoplakin Antibody [NBP2-49158] - Staining of human heart muscle show strong membranous and cytoplasmic positivity in intercalated disc in cardiomyocytes.
Immunohistochemistry-Paraffin: Desmoplakin Antibody [NBP2-49158] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Desmoplakin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGW
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DSP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Desmoplakin Recombinant Protein Antigen (NBP2-49158PEP)

Reactivity Notes

Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Desmoplakin Antibody

  • 250/210 kDa paraneoplastic pemphigus antigen
  • DCWHKTA
  • desmoplakin (DPI, DPII)
  • desmoplakin I
  • desmoplakin II
  • Desmoplakin
  • DP
  • DPI
  • DPII
  • DSP
  • KPPS2
  • PPKS2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53380
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Po, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-92546
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
MAB4077
Species: Hu
Applications: WB, IHC
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
H00005729-B01P
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-45041
Species: Hu, Po
Applications: Flow, ICC/IF, IF
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-75469
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
AF944
Species: Hu
Applications: WB, IHC
NB100-2737
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-49158
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for Desmoplakin Antibody (NBP2-49158) (0)

There are no publications for Desmoplakin Antibody (NBP2-49158).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Desmoplakin Antibody (NBP2-49158) (0)

There are no reviews for Desmoplakin Antibody (NBP2-49158). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Desmoplakin Antibody (NBP2-49158) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Desmoplakin Products

Bioinformatics Tool for Desmoplakin Antibody (NBP2-49158)

Discover related pathways, diseases and genes to Desmoplakin Antibody (NBP2-49158). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Desmoplakin Antibody (NBP2-49158)

Discover more about diseases related to Desmoplakin Antibody (NBP2-49158).
 

Pathways for Desmoplakin Antibody (NBP2-49158)

View related products by pathway.

PTMs for Desmoplakin Antibody (NBP2-49158)

Learn more about PTMs related to Desmoplakin Antibody (NBP2-49158).

Blogs on Desmoplakin

There are no specific blogs for Desmoplakin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Desmoplakin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DSP