Desmoglein-2 Antibody (NBP1-85709)

Images

 
Western Blot: Desmoglein-2 Antibody [NBP1-85709] - Analysis in human cell line A-431.
Immunocytochemistry/ Immunofluorescence: Desmoglein-2 Antibody [NBP1-85709] - Staining of human cell line A-431 shows positivity in plasma membrane.
Immunohistochemistry-Paraffin: Desmoglein-2 Antibody [NBP1-85709] - Staining of human prostate shows strong membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Desmoglein-2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:APPEDKVVPSFLPVDQGGSLVGRNGVGGMAKEATMKGSSSASIVKGQHEMSEMDGRWEEHRSLLSGRATQFTGATGAIMTTETTKTARATGASRDMAGAQAAAVALNEEFLRNYFTDKAASYTEEDENHTAKDCLLVYSQEETESLNAS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DSG2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation/permeabilization: PFA/Triton X-100.
Control Peptide
Desmoglein-2 Protein (NBP1-85709PEP)
Publications
Read Publication using NBP1-85709.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Desmoglein-2 Antibody

  • ARVC10
  • ARVD10
  • Cadherin family member 5
  • CDHF5
  • CDHF5MGC117034
  • CMD1BB
  • desmoglein 2
  • Desmoglein2
  • Desmoglein-2
  • DSG2
  • HDGC
  • MGC117036
  • MGC117037

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF7490
Species: Mu
Applications: IHC
MAB944
Species: Hu
Applications: WB, IHC
NBP1-86078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7265
Species: Mu
Applications: WB, IHC
NB100-1643
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-91612
Species: Mu
Applications: WB
NBP2-37557
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
AF1095
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88099
Species: Hu
Applications: Simple Western, IHC, IHC-P
NBP1-46852
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP1-84132
Species: Hu
Applications: IHC, IHC-P
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85709
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Desmoglein-2 Antibody (NBP1-85709)(1)

Reviews for Desmoglein-2 Antibody (NBP1-85709) (0)

There are no reviews for Desmoglein-2 Antibody (NBP1-85709). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Desmoglein-2 Antibody (NBP1-85709) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Desmoglein-2 Products

Related Products by Gene

Bioinformatics Tool for Desmoglein-2 Antibody (NBP1-85709)

Discover related pathways, diseases and genes to Desmoglein-2 Antibody (NBP1-85709). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Desmoglein-2 Antibody (NBP1-85709)

Discover more about diseases related to Desmoglein-2 Antibody (NBP1-85709).
 

Pathways for Desmoglein-2 Antibody (NBP1-85709)

View related products by pathway.

PTMs for Desmoglein-2 Antibody (NBP1-85709)

Learn more about PTMs related to Desmoglein-2 Antibody (NBP1-85709).

Blogs on Desmoglein-2

There are no specific blogs for Desmoglein-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Desmoglein-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DSG2
Entrez
Uniprot