Desmoglein-2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Desmoglein-2 Antibody [NBP1-85709] - Staining of human cell line A-431 shows localization to plasma membrane, cell junctions & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Desmoglein-2 Antibody [NBP1-85709] - Staining of human rectum shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Desmoglein-2 Antibody [NBP1-85709] - Staining of human heart muscle shows moderate positivity in intercalated discs.

Immunohistochemistry-Paraffin: Desmoglein-2 Antibody [NBP1-85709] - Staining of human prostate shows moderate to strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Desmoglein-2 Antibody [NBP1-85709] - Staining of human liver shows no positivity in hepatocytes as expected.

Analysis in human cell line BEWO.

Immunohistochemistry analysis in human rectum and liver tissues using HPA004896 antibody. Corresponding DSG2 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Desmoglein-2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Desmoglein-2 Antibody - BSA Free (NBP1-85709) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Desmoglein-2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: APPEDKVVPSFLPVDQGGSLVGRNGVGGMAKEATMKGSSSASIVKGQHEMSEMDGRWEEHRSLLSGRATQFTGATGAIMTTETTKTARATGASRDMAGAQAAAVALNEEFLRNYFTDKAASYTEEDENHTAKDCLLVYSQEETESLNAS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DSG2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Desmoglein-2 Protein (NBP1-85709PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Desmoglein-2 Antibody - BSA Free

• ARVC10
• ARVD10
• Cadherin family member 5
• CDHF5
• CDHF5MGC117034
• CMD1BB
• desmoglein 2
• Desmoglein2
• Desmoglein-2
• DSG2
• HDGC
• MGC117036
• MGC117037

Background

Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. Desmoglein 2 is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This second family member is expressed in colon, colon carcinoma, and other simple and stratified epithelial-derived cell lines.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Desmoglein-2 Antibody (NBP1-85709)(1)

Publication using NBP1-85709

• Asplund A, Gry Bjorklund M, Sundquist C et al. Expression profiling of microdissected cell populations selected from basal cells in normal epidermis and basal cell carcinoma. Br J Dermatol 2008-03-01 [PMID: 18241271]

Bioinformatics

• Gene Symbol: DSG2
• Entrez:
  • 1829(Human)
• Uniprot:
  • Q14126(Human)