Desmocollin-1 Antibody

Images

 
Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human skin shows moderate to strong membranous positivity in epidermal cells.
Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human fallopian tube shows very weak membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells.
Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Simple Western lane view shows a specific band for Desmocollin-1 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing ...read more
Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Electropherogram image(s) of corresponding Simple Western lane view. Desmocollin-1 antibody was used at 1:60 dilution on RT-4 and U-251MG lysate(s).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Desmocollin-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR
Specificity
Specificity of human Desmocollin-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DSC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Simple Western 1:60
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. Use in Western blot reported in scientific literature (PMID: 31158401).
Control Peptide
Desmocollin-1 Protein (NBP1-88099PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-88099 in the following applications:

Publications
Read Publications using
NBP1-88099 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Desmocollin-1 Antibody

  • cadherin family member 1
  • CDHF1
  • desmocollin 1
  • Desmocollin1
  • Desmocollin-1
  • desmosomal glycoprotein 2/3
  • DG2/DG3
  • DG2/DG3
  • DSC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF944
Species: Hu
Applications: WB, IHC
MAB7265
Species: Mu
Applications: WB, IHC
NBP1-85710
Species: Hu
Applications: IHC, IHC-P
NBP1-78984
Species: Hu, Mu
Applications: WB, DB, ICC/IF, IHC, IHC-P, IP
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF5725
Species: Hu
Applications: WB, IHC
AF947
Species: Hu
Applications: WB, Simple Western
AF2624
Species: Hu, Mu
Applications: WB, IHC, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-61736
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56546
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90042
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2008
Species: Hu
Applications: WB, IHC, IP
NBP2-33742
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NBP2-92546
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-90510
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Desmocollin-1 Antibody (NBP1-88099)(3)

Review for Desmocollin-1 Antibody (NBP1-88099) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Canine.

Reviews using NBP1-88099:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Canine
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin Desmocollin-1 NBP1-88099
Enlarge
5
reviewed by:
Mickaël Pinto
IHC-P Canine 11/07/2019
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedParaffin sections of canine folicular skin (dogs with pemphigus foliaceus)
SpeciesCanine
LotC113886

Comments

CommentsABSTRACT

Background
Pemphigus foliaceus is the most common autoimmune disease in dogs. It is characterized histologically by subcorneal pustules and acantholysis. Desmocollin-1 is the major target antigen of autoantibodies in dogs. Previous immunostaining studies have shown possible pathogenic similarities between canine and human pemphigus.

Objetives
To investigate the pathogenesis of acantholysis in canine Pemphigus Foliaceus, we decided to review the main histopathological findings and observe the variations of the labeling of desmocollin-1 by immunohistochemistry in skin biopsies from sick dogs.

Material and methods
Five cases of dogs with Pemphigus Foliaceus were selected and histopathological findings were reviewed by hematoxylin-eosin staining. Then the samples were stained following an immunohistochemical protocol, with an anti-desmocolin-1 antibody.

Results
The 5 cases presented typical histological characteristics of PFc: pustules in the superficial layers of the epidermis, acantholytic keratinocytes and neutrophilic exocytosis. We have validated the use of the anti-dsc-1 antibody in dogs, for immunhistochemistry in skin biopsies preserved in paraffin. We have observed that, in dogs with PF, the immunohistochemical pattern of desmocollin-1 was altered.

Conclusions
Staining of desmocollin-1 is altered in dogs with PF. We were able to corroborate the pathogenic mechanisms already demonstrated by immunohistochemistry. Thus, immunohistochemical staining for this protein may be useful in diagnosis. Its use, to study precise mechanisms, is limited and more biotechnologic tools are needed to complement the knowledge on this disease.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Desmocollin-1 Antibody (NBP1-88099) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Desmocollin-1 Products

Bioinformatics Tool for Desmocollin-1 Antibody (NBP1-88099)

Discover related pathways, diseases and genes to Desmocollin-1 Antibody (NBP1-88099). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Desmocollin-1 Antibody (NBP1-88099)

Discover more about diseases related to Desmocollin-1 Antibody (NBP1-88099).
 

Pathways for Desmocollin-1 Antibody (NBP1-88099)

View related products by pathway.

PTMs for Desmocollin-1 Antibody (NBP1-88099)

Learn more about PTMs related to Desmocollin-1 Antibody (NBP1-88099).

Blogs on Desmocollin-1

There are no specific blogs for Desmocollin-1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Mickaël Pinto
11/07/2019
Application: IHC-P
Species: Canine

Bioinformatics

Gene Symbol DSC1