Desmocollin-1 Antibody

Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human skin shows moderate to strong membranous positivity in epidermal cells.

Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human fallopian tube shows very weak membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells.

Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Simple Western lane view shows a specific band for Desmocollin-1 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Electropherogram image(s) of corresponding Simple Western lane view. Desmocollin-1 antibody was used at 1:60 dilution on RT-4 and U-251MG lysate(s).

• Reactivity: Hu
• Applications: WB, Simple Western, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Desmocollin-1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DSC1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western 1:60
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. Use in Western blot reported in scientific literature (PMID: 31158401).
• Control Peptide:

  Desmocollin-1 Protein (NBP1-88099PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Desmocollin-1 Antibody

• cadherin family member 1
• CDHF1
• desmocollin 1
• Desmocollin1
• Desmocollin-1
• desmosomal glycoprotein 2/3
• DG2/DG3
• DG2/DG3
• DSC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Desmocollin-1 Antibody (NBP1-88099)(3)

Publications using NBP1-88099

• Miyazaki H, Tsunoi Y, Akagi T et al. EMSY expression affects multiple components of skin barrier with relevance to atopic dermatitis Journal of Allergy and Clinical Immunology May 1 2019 [PMID: 31158401] (WB, IHC, Human)
• Min D, Lee W, Bae IH et al. Bioprinting of Biomimetic Skin containing Melanocytes. Exp. Dermatol. Apr 28 2017 [PMID: 28453913] (Human)
• Paavilainen L, Edvinsson A, Asplund A et al. The impact of tissue fixatives on morphology and antibody-based protein profiling in tissues and cells. J Histochem Cytochem 2010 Mar [PMID: 19901271]

Review for Desmocollin-1 Antibody (NBP1-88099) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Canine.

reviewed by: Mickaël Pinto IHC-P Canine 11/07/2019

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: Paraffin sections of canine folicular skin (dogs with pemphigus foliaceus)
• Species: Canine
• Lot: C113886

Comments

• Comments: ABSTRACT
  
  Background
  Pemphigus foliaceus is the most common autoimmune disease in dogs. It is characterized histologically by subcorneal pustules and acantholysis. Desmocollin-1 is the major target antigen of autoantibodies in dogs. Previous immunostaining studies have shown possible pathogenic similarities between canine and human pemphigus.
  
  Objetives
  To investigate the pathogenesis of acantholysis in canine Pemphigus Foliaceus, we decided to review the main histopathological findings and observe the variations of the labeling of desmocollin-1 by immunohistochemistry in skin biopsies from sick dogs.
  
  Material and methods
  Five cases of dogs with Pemphigus Foliaceus were selected and histopathological findings were reviewed by hematoxylin-eosin staining. Then the samples were stained following an immunohistochemical protocol, with an anti-desmocolin-1 antibody.
  
  Results
  The 5 cases presented typical histological characteristics of PFc: pustules in the superficial layers of the epidermis, acantholytic keratinocytes and neutrophilic exocytosis. We have validated the use of the anti-dsc-1 antibody in dogs, for immunhistochemistry in skin biopsies preserved in paraffin. We have observed that, in dogs with PF, the immunohistochemical pattern of desmocollin-1 was altered.
  
  Conclusions
  Staining of desmocollin-1 is altered in dogs with PF. We were able to corroborate the pathogenic mechanisms already demonstrated by immunohistochemistry. Thus, immunohistochemical staining for this protein may be useful in diagnosis. Its use, to study precise mechanisms, is limited and more biotechnologic tools are needed to complement the knowledge on this disease.

Bioinformatics

• Gene Symbol: DSC1