Desmocollin-1 Antibody

Images

 
Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human fallopian tube shows very weak membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human skin shows moderate to strong membranous positivity in epidermal cells.
Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells.
Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Simple Western lane view shows a specific band for Desmocollin-1 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing ...read more
Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Electropherogram image(s) of corresponding Simple Western lane view. Desmocollin-1 antibody was used at 1:60 dilution on RT-4 and U-251MG lysate(s).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Desmocollin-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DSC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Simple Western 1:60
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
Desmocollin-1 Protein (NBP1-88099PEP)
Publications
Read Publications using NBP1-88099.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Desmocollin-1 Antibody

  • cadherin family member 1
  • CDHF1
  • desmocollin 1
  • Desmocollin1
  • Desmocollin-1
  • desmosomal glycoprotein 2/3
  • DG2/DG3
  • DG2/DG3
  • DSC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB944
Species: Hu
Applications: WB, IHC
MAB7265
Species: Mu
Applications: WB, IHC
AF7490
Species: Mu
Applications: IHC
NBP1-78984
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF5725
Species: Hu
Applications: WB, IHC
AF947
Species: Hu
Applications: WB, Simple Western
AF2624
Species: Hu, Mu
Applications: WB, IHC, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-32962
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-90042
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2008
Species: Hu
Applications: WB, IHC, IP
NB100-2727
Species: Hu, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-85731
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
46780002
Species: Hu
Applications: ELISA
NBP1-90509
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88099
Species: Hu
Applications: Simple Western, IHC, IHC-P

Publications for Desmocollin-1 Antibody (NBP1-88099)(2)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Desmocollin-1 Antibody (NBP1-88099) (0)

There are no reviews for Desmocollin-1 Antibody (NBP1-88099). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Desmocollin-1 Antibody (NBP1-88099) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Desmocollin-1 Products

Bioinformatics Tool for Desmocollin-1 Antibody (NBP1-88099)

Discover related pathways, diseases and genes to Desmocollin-1 Antibody (NBP1-88099). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Desmocollin-1 Antibody (NBP1-88099)

Discover more about diseases related to Desmocollin-1 Antibody (NBP1-88099).
 

Pathways for Desmocollin-1 Antibody (NBP1-88099)

View related products by pathway.

PTMs for Desmocollin-1 Antibody (NBP1-88099)

Learn more about PTMs related to Desmocollin-1 Antibody (NBP1-88099).

Blogs on Desmocollin-1

There are no specific blogs for Desmocollin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Desmocollin-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DSC1
Entrez