Desmin Recombinant Protein Antigen

Images

 
There are currently no images for Desmin Protein (NBP1-85549PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Desmin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DES.

Source: E. coli

Amino Acid Sequence: KLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DES
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85549.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Desmin Recombinant Protein Antigen

  • CMD1I
  • CMD1IFLJ41013
  • CSM1
  • CSM2
  • DES
  • Desmin
  • FLJ12025
  • FLJ39719
  • FLJ41793
  • intermediate filament protein

Background

Desmin is the protein subunit of muscle-type intermediate filaments (IFs). Desmin is one of the five major groups of IFs and is found predominantly in skeletal, cardiac, and smooth muscle.DE-U-10 labels desmin in tumors derived from muscle tissue (leiomyomas and rhabdomyosarcomas) (Debus E et al.).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF4117
Species: Rt
Applications: IHC, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
NB110-58870
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KD, Simple Western, WB
NBP1-87102
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87103
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P
NB500-526
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
MAB4470
Species: All-Multi
Applications: Flow, ICC, IHC, WB
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, WB
MAB66861
Species: Hu
Applications: ICC, WB
291-G1
Species: Hu
Applications: BA
NBP3-03965
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NBP1-84854
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB

Publications for Desmin Protein (NBP1-85549PEP) (0)

There are no publications for Desmin Protein (NBP1-85549PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Desmin Protein (NBP1-85549PEP) (0)

There are no reviews for Desmin Protein (NBP1-85549PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Desmin Protein (NBP1-85549PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Desmin Products

Research Areas for Desmin Protein (NBP1-85549PEP)

Find related products by research area.

Blogs on Desmin.

Alpha-smooth muscle actin and the modulation of endothelial and epithelial cell biology
Actin is essential for a wide range of cell functions, ranging from cell division and chromatin remodeling to vesicle trafficking and maintenance of cellular structure. In fact, mislocalization of actin to cell junctions during development leads t...  Read full blog post.

Vimentin in Wound Healing
Vimentin is a fundamental 10 nm type III intermediate filament (IF) protein found in many mesenchymal and epithelia tissues, tissue culture cells, and developing neuronal and astrocytic precursor cells of the central nervous system. It frequently co-p...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Desmin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DES