
Western Blot: DEPTOR/DEPDC6 Antibody [NBP1-85256] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: DEPTOR/DEPDC6 Antibody [NBP1-85256] - Staining of human pancreas shows low expression as expected.
Western Blot: DEPTOR/DEPDC6 Antibody [NBP1-85256] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4
Immunohistochemistry: DEPTOR/DEPDC6 Antibody [NBP1-85256] - Staining of human lymph node shows strong cytoplasmic positivity in reaction center cells.
Immunohistochemistry: DEPTOR/DEPDC6 Antibody [NBP1-85256] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: DEPTOR/DEPDC6 Antibody [NBP1-85256] - Staining in human adrenal gland and pancreas tissues using anti-DEPTOR antibody. Corresponding DEPTOR RNA-seq data are presented for the same tissues.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

DEPTOR/DEPDC6 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LVTGEQLRLRLHEEKVIKDRRHHLKTYPNCFVAKELIDWLIEHKEASDRETAIKLMQKLADRGIIHHVCDEH
Specificity of human, mouse, rat DEPTOR/DEPDC6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DEPTOR/DEPDC6 Protein (NBP1-85256PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DEPTOR/DEPDC6 Antibody

  • DEP domain containing 6
  • DEP domain containing mTOR interacting protein
  • DEP domain containing MTOR-interacting protein
  • DEP domain-containing mTOR-interacting protein
  • DEP domain-containing protein 6
  • DEP.6
  • DEPDC6
  • DEPDC6FLJ12341
  • DKFZp564B1778
  • FLJ12428
  • FLJ13854


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P

Publications for DEPTOR/DEPDC6 Antibody (NBP1-85256) (0)

There are no publications for DEPTOR/DEPDC6 Antibody (NBP1-85256).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DEPTOR/DEPDC6 Antibody (NBP1-85256) (0)

There are no reviews for DEPTOR/DEPDC6 Antibody (NBP1-85256). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DEPTOR/DEPDC6 Antibody (NBP1-85256) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DEPTOR/DEPDC6 Products

Bioinformatics Tool for DEPTOR/DEPDC6 Antibody (NBP1-85256)

Discover related pathways, diseases and genes to DEPTOR/DEPDC6 Antibody (NBP1-85256). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DEPTOR/DEPDC6 Antibody (NBP1-85256)

Discover more about diseases related to DEPTOR/DEPDC6 Antibody (NBP1-85256).

Pathways for DEPTOR/DEPDC6 Antibody (NBP1-85256)

View related products by pathway.

PTMs for DEPTOR/DEPDC6 Antibody (NBP1-85256)

Learn more about PTMs related to DEPTOR/DEPDC6 Antibody (NBP1-85256).

Research Areas for DEPTOR/DEPDC6 Antibody (NBP1-85256)

Find related products by research area.


There are no specific blogs for DEPTOR/DEPDC6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DEPTOR/DEPDC6 Antibody and receive a gift card or discount.


Gene Symbol DEPTOR