DENR Antibody (1H3) - Azide and BSA Free

Western Blot: DENR Antibody (1H3) [H00008562-M01] - Analysis of DENR over-expressed 293 cell line, cotransfected with DENR Validated Chimera RNAi ( Cat # H00008562-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with DENR monoclonal antibody (M01), clone 1H3 (Cat # H00008562-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: DENR Antibody (1H3) [H00008562-M01] - Analysis of DENR expression in transfected 293T cell line by DENR monoclonal antibody (M01), clone 1H3.Lane 1: DENR transfected lysate(22.092 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA, Mycoplasma
• Clone: 1H3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

DENR Antibody (1H3) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: DENR (NP_003668, 1 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGIS
• Specificity: DENR - density-regulated protein
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: DENR
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Knockdown Validated
  • Western Blot
• Application Notes: Antibody reactivity against transfected lysate and recombinant protein for WB.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DENR Antibody (1H3) - Azide and BSA Free

• density-regulated protein
• DRP1Protein DRP1
• DRPsmooth muscle cell associated protein-3
• SMAP-3
• Smooth muscle cell-associated protein 3

Background

This gene encodes a protein whose expression was found to increase in cultured cells at high density but not during growth arrest. This gene was also shown to have increased expression in cells overexpressing HER-2/neu proto-oncogene. The protein contains an SUI1 domain. In budding yeast, SUI1 is a translation initiation factor that along with eIF-2 and the initiator tRNA-Met, directs the ribosome to the proper translation start site. Proteins similar to SUI have been found in mammals, insects, and plants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DENR Antibody (H00008562-M01)(1)

Publication using H00008562-M01

• David Y, Sezen M, Nicholas G et al. 40S ribosome profiling reveals distinct roles for Tma20/Tma22 (MCT-1/DENR) and Tma64 (eIF2D) in 40S subunit recycling. Nat Commun. 2021-05-20 [PMID: 34016977]

Bioinformatics

• Gene Symbol: DENR
• Entrez:
  • 8562(Human)
• OMIM:
  • 604550(Human)
• Uniprot:
  • NP_003668(Human)