DENR Antibody (1H3)

Images

 
Western Blot: DENR Antibody (1H3) [H00008562-M01] - Analysis of DENR over-expressed 293 cell line, cotransfected with DENR Validated Chimera RNAi ( Cat # H00008562-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Western Blot: DENR Antibody (1H3) [H00008562-M01] - Analysis of DENR expression in transfected 293T cell line by DENR monoclonal antibody (M01), clone 1H3.Lane 1: DENR transfected lysate(22.092 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, RNAi
Clone
1H3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DENR Antibody (1H3) Summary

Immunogen
DENR (NP_003668, 1 a.a. - 81 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGIS
Specificity
DENR - density-regulated protein
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DENR
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • RNA Inhibition
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DENR Antibody (1H3)

  • density-regulated protein
  • DRP1Protein DRP1
  • DRPsmooth muscle cell associated protein-3
  • SMAP-3
  • Smooth muscle cell-associated protein 3

Background

This gene encodes a protein whose expression was found to increase in cultured cells at high density but not during growth arrest. This gene was also shown to have increased expression in cells overexpressing HER-2/neu proto-oncogene. The protein contains an SUI1 domain. In budding yeast, SUI1 is a translation initiation factor that along with eIF-2 and the initiator tRNA-Met, directs the ribosome to the proper translation start site. Proteins similar to SUI have been found in mammals, insects, and plants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-55288
Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56646
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
H00009927-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-84074
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-55290
Species: Hu, Mu, Rt, Po, Ch, Ze
Applications: WB, Simple Western, IB, IHC, IHC-P
H00055669-M04
Species: Hu, Mu
Applications: WB, ELISA, Flow
NB100-2357
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P, IP, ChIP
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-01512
Species: Hu, Pm
Applications: WB, Flow, IHC, IHC-P
NB110-60491
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, Flow, IHC, IHC-Fr, IHC-P
NBP2-75531
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
BC100-494
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PEP-ELISA, PAGE, KD, KO
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB500-213
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-89138
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for DENR Antibody (H00008562-M01) (0)

There are no publications for DENR Antibody (H00008562-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DENR Antibody (H00008562-M01) (0)

There are no reviews for DENR Antibody (H00008562-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DENR Antibody (H00008562-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DENR Products

Bioinformatics Tool for DENR Antibody (H00008562-M01)

Discover related pathways, diseases and genes to DENR Antibody (H00008562-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DENR Antibody (H00008562-M01)

Discover more about diseases related to DENR Antibody (H00008562-M01).
 

Pathways for DENR Antibody (H00008562-M01)

View related products by pathway.

PTMs for DENR Antibody (H00008562-M01)

Learn more about PTMs related to DENR Antibody (H00008562-M01).

Blogs on DENR

There are no specific blogs for DENR, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DENR Antibody (1H3) and receive a gift card or discount.

Bioinformatics

Gene Symbol DENR
Entrez
OMIM
Uniprot
COVID-19 update