Defensin alpha 5 Antibody

Images

 
Western Blot: Defensin alpha 5 Antibody [NBP1-84282] - Analysis in control (vector only transfected HEK293T lysate) and DEFA5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Defensin alpha 5 Antibody [NBP1-84282] - Staining in human small intestine and placenta tissues using anti-DEFA5 antibody. Corresponding DEFA5 RNA-seq data ...read more
Western Blot: Defensin alpha 5 Antibody [NBP1-84282] - Analysis in human small intestine tissue.
Immunohistochemistry-Paraffin: Defensin alpha 5 Antibody [NBP1-84282] - Staining of human placenta shows low expression as expected.
Immunohistochemistry-Paraffin: Defensin alpha 5 Antibody [NBP1-84282] - Staining of human small intestine shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Defensin alpha 5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR
Specificity
Specificity of human Defensin alpha 5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DEFA5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Defensin alpha 5 Protein (NBP1-84282PEP)
Publications
Read Publication using NBP1-84282.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Defensin alpha 5 Antibody

  • alpha-Defensin 5
  • DEF5
  • DEF5defensin, alpha 5, preproprotein
  • DEFA5
  • defensin 5
  • Defensin alpha 5
  • Defensin, alpha 5
  • defensin, alpha 5, Paneth cell-specific
  • defensin-5
  • HD-5
  • MGC129728

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-97543
Species: Hu
Applications: IHC, IHC-P
H00006934-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
AF2758
Species: Hu
Applications: WB, IHC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
MAB208
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-22152
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P, ChIP
NBP2-61118
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-75531
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
7270-IL/CF
Species: Hu
H00006925-M03
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
AF8198
Species: Hu
Applications: ELISA, IHC
NB100-56566
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, B/N, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), Flow-CS, Flow-IC, KD, KO
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Pm, Pm
Applications: WB, Simple Western, DB, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, B/N, CyTOF-ready, Flow-IC, KD

Publications for Defensin alpha 5 Antibody (NBP1-84282)(1)

Reviews for Defensin alpha 5 Antibody (NBP1-84282) (0)

There are no reviews for Defensin alpha 5 Antibody (NBP1-84282). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Defensin alpha 5 Antibody (NBP1-84282) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Defensin alpha 5 Products

Bioinformatics Tool for Defensin alpha 5 Antibody (NBP1-84282)

Discover related pathways, diseases and genes to Defensin alpha 5 Antibody (NBP1-84282). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Defensin alpha 5 Antibody (NBP1-84282)

Discover more about diseases related to Defensin alpha 5 Antibody (NBP1-84282).
 

Pathways for Defensin alpha 5 Antibody (NBP1-84282)

View related products by pathway.

Research Areas for Defensin alpha 5 Antibody (NBP1-84282)

Find related products by research area.

Blogs on Defensin alpha 5.

Toll-like receptors in the intestinal epithelial cells
By Jamshed Arslan, Pharm. D., PhD. Toll-like receptors (TLRs) are microbe-sensing proteins that act as first responders to danger signals. TLRs help the intestinal epithelial cells (IECs) recognize commensal bacteria...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Defensin alpha 5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DEFA5