Death Ligand Signal Enhancer Antibody

Images

 
Western Blot: Death Ligand Signal Enhancer Antibody [H00009812-B01P] - Analysis of KIAA0141 expression in transfected 293T cell line by KIAA0141 polyclonal antibody. Lane 1: KIAA0141 transfected lysate(56.65 KDa). Lane ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Death Ligand Signal Enhancer Antibody Summary

Immunogen
KIAA0141 (NP_055588, 1 a.a. - 515 a.a.) full-length human protein. MWRLPGLLGRALPRTLGPSLWRVTPKSTSPDGPQTTSSTLLVPVPNLDRSGPHGPGTSGGPRSHGWKDAFQWMSSRVSPNTLWDAISWGTLAVLALQLARQIHFQASLPAGPQRVEHCSWHSPLDRFFSSPLWHPCSSLRQHILPSPDGPAPRHTGLREPRLGQEEASAQPRNFSHNSLRGARPQDPSEEGPGDFGFLHASSSIESEAKPAQPQPTGEKEQDKSKTLSLEEAVTSIQQLFQLSVSITFNFLGTENMKSGDHTAAFSYFQKAAARGYSKAQYNAGLCHEHGRGTPRDISKAVLYYQLAASQGHSLAQYRYARCLLRDPASSWNPERQRAVSLLKQAADSGLREAQAFLGVLFTKEPYLDEQRAVKYLWLAANNGDSQSRYHLGICYEKGLGVQRNLGEALRCYQQSAALGNEAAQERLRALFSMGAAAPGPSDLTVTGLKSFSSPSLCSLNTLLAGTSRLPHASSTGNLGLLCRSGHLGASLEASSRAIPPHPYPLERSVVRLGFG
Specificity
KIAA0141 - KIAA0141,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
KIAA0141
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Death Ligand Signal Enhancer Antibody

  • DAP3 Binding Cell Death Enhancer 1
  • DAP3-Binding Cell Death Enhancer 1
  • DAP3-Binding Cell Death Enhancer 1, Long Form
  • Death Ligand Signal Enhancer
  • DELE
  • DELE1
  • DELE1(L)
  • hypothetical protein LOC9812
  • KIAA0141

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88568
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
375-TL
Species: Hu
Applications: BA
NBP1-76544
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
NB100-56708
Species: Ch, ChHa, Hu, Ma, Mu, Po, Rt
Applications: CyTOF-ready, EM, Flow, HEStain, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, KD, KO, Simple Western, WB
NB100-56118
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-56116
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB300-917
Species: Hu, Mu
Applications: IF, IHC, IHC-P
H00054778-M05
Species: Hu
Applications: ELISA, ICC/IF, KD, WB
NBP1-88866
Species: Hu
Applications: IHC, IHC-P
NBP1-89766
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88420
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-66881
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00009812-B01P
Species: Hu
Applications: WB

Publications for Death Ligand Signal Enhancer Antibody (H00009812-B01P) (0)

There are no publications for Death Ligand Signal Enhancer Antibody (H00009812-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Death Ligand Signal Enhancer Antibody (H00009812-B01P) (0)

There are no reviews for Death Ligand Signal Enhancer Antibody (H00009812-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Death Ligand Signal Enhancer Antibody (H00009812-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Death Ligand Signal Enhancer Products

Bioinformatics Tool for Death Ligand Signal Enhancer Antibody (H00009812-B01P)

Discover related pathways, diseases and genes to Death Ligand Signal Enhancer Antibody (H00009812-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Death Ligand Signal Enhancer

There are no specific blogs for Death Ligand Signal Enhancer, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Death Ligand Signal Enhancer Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA0141
Entrez
Uniprot