Recombinant Human DEAF1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human DEAF1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 466-564 of Human DEAF1

Source: Wheat Germ

Amino Acid Sequence: TAQQLKTLFEQAKHASTYREAATNQAKIHADAERKEQSCVNCGREAMSECTGCHKVNYCSTFCQRKDWKDHQHICGQSAAVTVQADEVHVAESVMEKVT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
DEAF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DEAF1 Protein

  • deformed epidermal autoregulatory factor 1 (Drosophila)
  • Nuclear DEAF-1-related transcriptional regulator
  • NUDRdeformed epidermal autoregulatory factor 1 homolog
  • SPNsuppressin
  • Zinc finger MYND domain-containing protein 5
  • ZMYND5Suppressin

Background

DEAF1 - deformed epidermal autoregulatory factor 1 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86614
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P

Publications for DEAF1 Partial Recombinant Protein (H00010522-Q01) (0)

There are no publications for DEAF1 Partial Recombinant Protein (H00010522-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DEAF1 Partial Recombinant Protein (H00010522-Q01) (0)

There are no reviews for DEAF1 Partial Recombinant Protein (H00010522-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DEAF1 Partial Recombinant Protein (H00010522-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DEAF1 Products

Bioinformatics Tool for DEAF1 Partial Recombinant Protein (H00010522-Q01)

Discover related pathways, diseases and genes to DEAF1 Partial Recombinant Protein (H00010522-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DEAF1 Partial Recombinant Protein (H00010522-Q01)

Discover more about diseases related to DEAF1 Partial Recombinant Protein (H00010522-Q01).
 

Pathways for DEAF1 Partial Recombinant Protein (H00010522-Q01)

View related products by pathway.

PTMs for DEAF1 Partial Recombinant Protein (H00010522-Q01)

Learn more about PTMs related to DEAF1 Partial Recombinant Protein (H00010522-Q01).

Blogs on DEAF1

There are no specific blogs for DEAF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DEAF1 Antibody
NBP2-47489

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DEAF1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DEAF1