DDX42 Antibody

Images

 
Western Blot: DDX42 Antibody [NBP1-87133] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: DDX42 Antibody [NBP1-87133] - Staining of human cell line U-251 MG shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: DDX42 Antibody [NBP1-87133] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.
Western Blot: DDX42 Antibody [NBP1-87133] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DDX42 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TAGVVQEEEEDNLEYDSDGNPIAPTKKIIDPLPPIDHSEIDYPPFEKNFYNEHEEITNLTPQQLIDLRHKLNLRVSGAAPPRPGSSFAHFGFDEQLMHQIRKSEYTQPTPIQCQG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DDX42
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DDX42 Protein (NBP1-87133PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DDX42 Antibody

  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 42
  • DEAD box protein 42
  • EC 3.6.1
  • EC 3.6.4.13
  • RHELPSF3b DEAD box protein
  • RNA helicase-like protein
  • RNA helicase-related protein
  • RNAHPFLJ43179
  • SF3b125 DEAD-box protein
  • SF3b125ATP-dependent RNA helicase DDX42
  • Splicing factor 3B-associated 125 kDa protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
26260002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-47442
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
NBP1-18878
Species: Hu
Applications: WB, IHC-P, IP
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24679
Species: Hu, Po, Bv, Ca, Pm
Applications: WB, IHC-P
H00051428-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NB100-1713
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB200-351
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
H00010714-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-793
Species: Hu
Applications: WB, PEP-ELISA
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-97856
Species: Hu, Mu, Rt
Applications: WB

Publications for DDX42 Antibody (NBP1-87133) (0)

There are no publications for DDX42 Antibody (NBP1-87133).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX42 Antibody (NBP1-87133) (0)

There are no reviews for DDX42 Antibody (NBP1-87133). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DDX42 Antibody (NBP1-87133) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DDX42 Products

Bioinformatics Tool for DDX42 Antibody (NBP1-87133)

Discover related pathways, diseases and genes to DDX42 Antibody (NBP1-87133). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX42 Antibody (NBP1-87133)

Discover more about diseases related to DDX42 Antibody (NBP1-87133).
 

Pathways for DDX42 Antibody (NBP1-87133)

View related products by pathway.

PTMs for DDX42 Antibody (NBP1-87133)

Learn more about PTMs related to DDX42 Antibody (NBP1-87133).

Blogs on DDX42

There are no specific blogs for DDX42, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DDX42 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX42