DDX42 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DDX42 Antibody [NBP1-87133] - Staining of human cell line U-251 MG shows localization to nuclear speckles.

Immunohistochemistry-Paraffin: DDX42 Antibody [NBP1-87133] - Staining of human Lymph node shows strong nuclear positivity in germinal center and non-germinal center cells.

Immunohistochemistry-Paraffin: DDX42 Antibody [NBP1-87133] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: DDX42 Antibody [NBP1-87133] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: DDX42 Antibody [NBP1-87133] - Staining of human Liver shows very weak positivity in hepatocytes.

Immunohistochemistry-Paraffin: DDX42 Antibody [NBP1-87133] - Staining of human Testis shows strong nuclear positivity in Leydig cells and cells in seminiferous ducts.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DDX42 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DDX42 Antibody - BSA Free (NBP1-87133) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TAGVVQEEEEDNLEYDSDGNPIAPTKKIIDPLPPIDHSEIDYPPFEKNFYNEHEEITNLTPQQLIDLRHKLNLRVSGAAPPRPGSSFAHFGFDEQLMHQIRKSEYTQPTPIQCQG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DDX42
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DDX42 Protein (NBP1-87133PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DDX42 Antibody - BSA Free

• DEAD (Asp-Glu-Ala-Asp) box polypeptide 42
• DEAD box protein 42
• EC 3.6.1
• EC 3.6.4.13
• RHELPSF3b DEAD box protein
• RNA helicase-like protein
• RNA helicase-related protein
• RNAHPFLJ43179
• SF3b125 DEAD-box protein
• SF3b125ATP-dependent RNA helicase DDX42
• Splicing factor 3B-associated 125 kDa protein

Background

DDX42 encodes a member of the Asp-Glu-Ala-Asp (DEAD) box protein family. Members of this protein family are putative RNA helicases, and are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DDX42