DDX3 Antibody (2D7) - Azide and BSA Free

Western Blot: DDX3 Antibody (2D7) [H00008653-M01] - DDX3Y monoclonal antibody (M01), clone 2D7. Analysis of DDX3Y expression in NIH/3T3.

Immunohistochemistry-Paraffin: DDX3 Antibody (2D7) [H00008653-M01] - Analysis of monoclonal antibody to DDX3Y on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.

Western Blot: DDX3 Antibody (2D7) [H00008653-M01] - DDX3Y monoclonal antibody (M01), clone 2D7. Analysis of DDX3Y expression in Raw 264.7.

Western Blot: DDX3 Antibody (2D7) [H00008653-M01] - DDX3Y monoclonal antibody (M01), clone 2D7. Analysis of DDX3Y expression in mouse testis.

Sandwich ELISA: DDX3 Antibody (2D7) [H00008653-M01] - Detection limit for recombinant GST tagged DDX3Y is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, IHC
• Clone: 2D7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

DDX3 Antibody (2D7) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: DDX3Y (NP_004651, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSHVVVKNDPELDQQLANLDLNSEKQSGGASTASKGRYIPPHLRNREASKGFHDKDSSGWSCSKDKDAYSSFGSRDSRGK
• Specificity: This antibody was raised to human DDX3Y fragment, however it is known to crossreact with DDX3X.
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: DDX3X
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DDX3 Antibody (2D7) - Azide and BSA Free

• DBXCAP-Rf
• DDX14
• DDX3DEAD/H box-3
• DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked
• DEAD box protein 3, X-chromosomal
• DEAD box, X isoform
• DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3
• EC 3.6.1
• EC 3.6.4.13
• helicase like protein 2
• Helicase-like protein 2
• HLP2ATP-dependent RNA helicase DDX3X

Background

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, and it has a homolog on the X chromosome. The gene mutation causes male infertility, Sertoli cell-only syndrome or severe hypospermatogenesis, suggesting that this gene plays a key role in the spermatogenic process. Alternatively spliced variants, encoding the same protein, have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DDX3X
• Entrez:
  • 8653(Human)
• OMIM:
  • 400010(Human)
• Uniprot:
  • NP_004651(Human)