DDX3 Antibody (2D7)

Images

 
Western Blot: DDX3 Antibody (2D7) [H00008653-M01] - DDX3Y monoclonal antibody (M01), clone 2D7. Analysis of DDX3Y expression in NIH/3T3.
Immunohistochemistry-Paraffin: DDX3 Antibody (2D7) [H00008653-M01] - Analysis of monoclonal antibody to DDX3Y on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Western Blot: DDX3 Antibody (2D7) [H00008653-M01] - DDX3Y monoclonal antibody (M01), clone 2D7. Analysis of DDX3Y expression in Raw 264.7.
Western Blot: DDX3 Antibody (2D7) [H00008653-M01] - DDX3Y monoclonal antibody (M01), clone 2D7. Analysis of DDX3Y expression in mouse testis.
Sandwich ELISA: DDX3 Antibody (2D7) [H00008653-M01] - Detection limit for recombinant GST tagged DDX3Y is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
2D7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DDX3 Antibody (2D7) Summary

Immunogen
DDX3Y (NP_004651, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSHVVVKNDPELDQQLANLDLNSEKQSGGASTASKGRYIPPHLRNREASKGFHDKDSSGWSCSKDKDAYSSFGSRDSRGK
Specificity
This antibody was raised to human DDX3Y fragment, however it is known to crossreact with DDX3X.
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DDX3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DDX3 Antibody (2D7)

  • DBXCAP-Rf
  • DDX14
  • DDX3DEAD/H box-3
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked
  • DEAD box protein 3, X-chromosomal
  • DEAD box, X isoform
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3
  • EC 3.6.1
  • EC 3.6.4.13
  • helicase like protein 2
  • Helicase-like protein 2
  • HLP2ATP-dependent RNA helicase DDX3X

Background

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, and it has a homolog on the X chromosome. The gene mutation causes male infertility, Sertoli cell-only syndrome or severe hypospermatogenesis, suggesting that this gene plays a key role in the spermatogenic process. Alternatively spliced variants, encoding the same protein, have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-16963
Species: Hu
Applications: ELISA, ICC/IF, IHC-P, WB
H00054606-M05
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NB100-80859
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-27419
Species: Hu, Pm
Applications: IHC, IHC-P, WB
NB100-56705
Species: Bv, Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
NB200-351
Species: Ha, Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
42400-1
Species: Mu
Applications: ELISA
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-67741
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-61745
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
AF2030
Species: Hu
Applications: IHC, WB
1845-SH/CF
Species: Hu
Applications: BA
NBP2-81711
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-80628
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for DDX3 Antibody (H00008653-M01) (0)

There are no publications for DDX3 Antibody (H00008653-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX3 Antibody (H00008653-M01) (0)

There are no reviews for DDX3 Antibody (H00008653-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DDX3 Antibody (H00008653-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DDX3 Products

Array H00008653-M01

Bioinformatics Tool for DDX3 Antibody (H00008653-M01)

Discover related pathways, diseases and genes to DDX3 Antibody (H00008653-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX3 Antibody (H00008653-M01)

Discover more about diseases related to DDX3 Antibody (H00008653-M01).
 

Pathways for DDX3 Antibody (H00008653-M01)

View related products by pathway.

PTMs for DDX3 Antibody (H00008653-M01)

Learn more about PTMs related to DDX3 Antibody (H00008653-M01).

Blogs on DDX3

There are no specific blogs for DDX3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DDX3 Antibody (2D7) and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX3
Entrez
OMIM
Uniprot