DDX19B Antibody - Azide and BSA Free

Western Blot: DDX19B Antibody [H00011269-B01P] - Analysis of DDX19B expression in transfected 293T cell line by DDX19B polyclonal antibody. Lane1:DDX19B transfected lysate(52.69 KDa). Lane2:Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

DDX19B Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse DDX19B Antibody - Azide and BSA Free (H00011269-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: DDX19B (NP_009173.1, 1 a.a. - 479 a.a.) full-length human protein. MATDSWALAVDEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: DDX19B
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is useful for Western Blot, Functional

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DDX19B Antibody - Azide and BSA Free

• ATP-dependent RNA helicase DDX19
• DBP5ATP-dependent RNA helicase DDX19B
• DDX19DEAD-box protein 5
• DEAD (Asp-Glu-Ala-As) box polypeptide 19
• DEAD (Asp-Glu-Ala-As) box polypeptide 19B
• DEAD box protein 19B
• DEAD box RNA helicase DEAD5
• DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 19 (Dbp5, yeast, homolog)
• DEAD-box RNA helicase DEAD5
• EC 3.6.1
• EC 3.6.4.13
• RNAh
• yeast Dbp5 homolog

Background

DDX19B, also known as ATP-dependent RNA helicase DDX19B, consists of four isoforms of sizes 53.9 kDa, 50.5 kDa, 41.8 kDa, and 51 kDa and is involved in exporting mRNA from the nucleus by remodeling the ribonucleoprotein particles instead of unwinding RNA duplexes. Current research is linking the protein to diseases and disorders such as apraxia, pneumonia, Werner syndrome, malaria, and locked-in syndrome. The protein interacts in protein transport pathways with PRKAG1, CDC5L, RAE1, UBA5, and SNW1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DDX19B
• Uniprot:
  • NP_009173.1(Human)