DDO Antibody (3F7)

Images

 
Western Blot: DDO Antibody (3F7) [H00008528-M09] - Analysis of DDO expression in transfected 293T cell line by DDO monoclonal antibody (M09), clone 3F7. Lane 1: DDO transfected lysate (Predicted MW: 41 KDa). Lane 2: ...read more
Sandwich ELISA: DDO Antibody (3F7) [H00008528-M09] - Detection limit for recombinant GST tagged DDO is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3F7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DDO Antibody (3F7) Summary

Immunogen
DDO (NP_003640 270 a.a. - 369 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WNLSPDAENSREILSRCCALEPSLHGACNIREKVGLRPYRPGVRLQTELLARDGQRLPVVHHYGHGSGGISVHWGTALEAARLVSECVHALRTPIPKSNL
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DDO
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DDO Antibody (3F7)

  • aspartic oxidase
  • DASOX
  • D-aspartate oxidase
  • DDO-1
  • DDO-2
  • EC 1.4.3.1
  • FLJ45203

Background

The protein encoded by this gene is a peroxisomal flavoprotein that catalyzes the oxidative deamination of D-aspartate and N-methyl D-aspartate. Flavin adenine dinucleotide or 6-hydroxyflavin adenine dinucleotide can serve as the cofactor in this reaction. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84304
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-58006
Species: Hu
Applications: WB, IHC, IHC-P
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
MAB2476
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4409
Species: Mu
Applications: WB
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34980
Species: Hu
NBP1-88543
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-54755
Species: Hu
Applications: WB
NBP2-46234
Species: Hu
Applications: WB, IHC
H00008528-M09
Species: Hu
Applications: WB, ELISA

Publications for DDO Antibody (H00008528-M09) (0)

There are no publications for DDO Antibody (H00008528-M09).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDO Antibody (H00008528-M09) (0)

There are no reviews for DDO Antibody (H00008528-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DDO Antibody (H00008528-M09) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DDO Products

Bioinformatics Tool for DDO Antibody (H00008528-M09)

Discover related pathways, diseases and genes to DDO Antibody (H00008528-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDO Antibody (H00008528-M09)

Discover more about diseases related to DDO Antibody (H00008528-M09).
 

Pathways for DDO Antibody (H00008528-M09)

View related products by pathway.

PTMs for DDO Antibody (H00008528-M09)

Learn more about PTMs related to DDO Antibody (H00008528-M09).

Blogs on DDO

There are no specific blogs for DDO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DDO Antibody (3F7) and receive a gift card or discount.

Bioinformatics

Gene Symbol DDO
Uniprot