DDIT4L Antibody - Azide and BSA Free

Western Blot: DDIT4L Antibody [H00115265-B01P] - Analysis of DDIT4L expression in transfected 293T cell line by DDIT4L polyclonal antibody. Lane 1: DDIT4L transfected lysate(21.23 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

DDIT4L Antibody - Azide and BSA Free Summary

• Immunogen: DDIT4L (NP_660287.1, 1 a.a. - 193 a.a.) full-length human protein. MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDSSVVPTFELTLVFKQENCSWTSFRDFFFSRGRFSSGFRRTLILSSGFRLVKKKLYSLIGTTVIEGS
• Specificity: DDIT4L - DNA-damage-inducible transcript 4-like,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: DDIT4L
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DDIT4L Antibody - Azide and BSA Free

• DNA damage-inducible transcript 4-like protein
• DNA-damage-inducible transcript 4-like
• HIF-1 responsive protein RTP801-like
• homolog of mouse SMHS1
• Protein regulated in development and DNA damage response 2
• REDD-2
• REDD2Rtp801L
• regulated in development and DNA damage response 2
• RTP801L

Background

DDIT4L, also known as DNA damage-inducible transcript 4-like protein, is a 21.7 kDa 193 amino acid protein that regulates the TOR signaling pathway between the TSC1-TSC2 complex and AKT1, thus inhibiting cell growth. Current research is being conducted with diseases and disorders such as teratoma, melanoma, and hypoxia. The protein is involved in the TOR signaling pathway, where it interacts with SNRPG and PRKAB2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DDIT4L
• Entrez:
  • 115265(Human)
• Uniprot:
  • NP_660287.1(Human)