DDIT4L Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse DDIT4L Antibody - Azide and BSA Free (H00115265-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
DDIT4L (NP_660287.1, 1 a.a. - 193 a.a.) full-length human protein. MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDSSVVPTFELTLVFKQENCSWTSFRDFFFSRGRFSSGFRRTLILSSGFRLVKKKLYSLIGTTVIEGS |
| Specificity |
DDIT4L - DNA-damage-inducible transcript 4-like, |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
DDIT4L |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for DDIT4L Antibody - Azide and BSA Free
Background
DDIT4L, also known as DNA damage-inducible transcript 4-like protein, is a 21.7 kDa 193 amino acid protein that regulates the TOR signaling pathway between the TSC1-TSC2 complex and AKT1, thus inhibiting cell growth. Current research is being conducted with diseases and disorders such as teratoma, melanoma, and hypoxia. The protein is involved in the TOR signaling pathway, where it interacts with SNRPG and PRKAB2.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Publications for DDIT4L Antibody (H00115265-B01P) (0)
There are no publications for DDIT4L Antibody (H00115265-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DDIT4L Antibody (H00115265-B01P) (0)
There are no reviews for DDIT4L Antibody (H00115265-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DDIT4L Antibody (H00115265-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DDIT4L Products
Research Areas for DDIT4L Antibody (H00115265-B01P)
Find related products by research area.
|
Blogs on DDIT4L